KEGG   Toxoplasma gondii: TGME49_201650Help
Entry
TGME49_201650     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 7897451
NCBI-ProteinID: XP_002367461
UniProt: S8F6D9
Position
VIIa:complement(join(3875327..3875626,3876400..3876581,3876986..3879890))
Genome map
AA seq 1128 aa AA seqDB search
MLHSQVPFDTSLSNRLPAHHTSLPATNPAYDSEVVHILPQVNSDSNRMVTVSPAKERMAS
TELQALQIPESVDPSADHDFLYTSRSRSPESAVEEPLPAQSQSSKAGQMVETQGEPGTGL
SASSLDAADRADPVAILSDPRKPESSQTAVPRPSGSSGAPAPLTSVTPAATGTRETYATL
ESSISGVDIITIPDNLSDMIRNPGIQSRRPMNSGSSSNRPSSGENGSDVNRPKATSTNSA
TKKIIDLTLTQSPTMFDLFMEQEAAEGITPGADLAPTLMEEASVSQWPDAASQLQTTQTG
EKESPSEEEGLGNPDDDEEENDEDEEEEDDINTEEEDPQPRRTYPVPLPLPIPISFPWLG
GLGGGGLGLLSVRGPSAPQPDSPAVPPLDPSTALGVGNGVHPHLSPSMPLKVEEGVISNI
ASSTSMPALRASSAGMAPDTWFAPNAGNQVLPPSSGAFLERTTAPPVFTSVVPSTMVPRI
FEADPGLPIPASHSVGSTPSSAPPHTPALANADSVAPPTTPLSVAFGSVGARPFPDTLPV
ASEVAIARVSPQNSYTTGSTGVHSLSQNGSTPPAWQPTETQHSLPVYGNTLPPRNHGPGM
HRSIYSASGDVSPTSGIGVKPLVGGEGTISRLSVATARDQAFAASTSPRLPSLTQTAPGL
SLLDDVHARTGSAAGWGSNIAGAGTVSSFSIPSSLYPESIHSVSSFQGPSSLHSPAFASS
TLGSPISSGSPHSSTKIPTPLTTSTPSSPAHSDTSGSLSPVLASTTTVLPELPKRTQQSI
TSHDVHEVARSSPGISSTTPAGFYSGSVNPSSFSTELSNLVYSSTTSSAFDSPAGTTVSS
RGGNLGGARASPVSIPRGPSSLSHPGASPSLSTPGVSAGAGIKTREGVGSGGIAAAGSAA
AGVSRQLPGAVTAMPAIVQSADQLFTSTSSFIGVGNSLIKSFPFEEALEWSQQRNEARKE
QKEKPPTHLGQPWVRCVSSGMTCCIPQKAVGGDWKKKPPYLNESPAENRACQAHFVPMQN
AVCASTAYEVSKKAIAEKQQRRDKTNKVAQGVGAALKTTALLTQQGSDAMHSSLAGMERA
QGDPAAQVQEIRGGVKAIADLLMKTSDTSPAMSMVTKALDDLAYLQKK
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattcccaggtcccttttgatacatcgttatcgaaccgtttacctgctcaccat
accagcttgccagcaacgaaccccgcatacgattccgaagtggttcatatactgcctcaa
gtgaactctgacagtaaccggatggtcacagtctccccagccaaagagcggatggcgtca
acggagttgcaggcattacagattccagaatctgtcgatccttcggctgaccatgatttc
ctgtatacgtctcgtagccgttctcctgaatctgccgttgaggaaccactaccagcacag
agccagtcctcaaaggcggggcaaatggtagaaacccaaggggagcctggtaccggcctg
tctgcgtctagtctcgacgcggctgacagagctgatccggtggctatcctgagtgaccct
cgaaaaccagaaagttctcaaactgctgttccacgtccatcaggttcgagtggcgcgccg
gcaccgctgacctccgttactccagcagccacaggcacgagagagacgtatgcaacgttg
gaatctagtatttctggagttgatatcatcacaatccctgacaacctatccgatatgata
cgaaatcctgggatacaaagccgtcgcccaatgaatagtggctcgagcagcaatcgtccc
agttccggtgagaatggaagcgatgtcaacaggccgaaagcaacatcgacaaatagtgca
acaaagaaaataattgatctgactctgacacaaagtcctaccatgtttgacctgttcatg
gaacaagaagctgcggaaggcattacgcctggggcagacctcgctcccacgctcatggaa
gaggcatctgtgtcgcaatggcctgatgccgcttctcagcttcagacaacacagacagga
gagaaggagtctccgagcgaagaagaagggctagggaatccagatgatgacgaagaagag
aatgatgaagatgaagaagaggaagatgatattaacacagaagaggaagatccacagcca
cgtcgcacgtatcctgtccctcttcctcttcccattccaatcagcttcccatggcttgga
ggcctcgggggaggtggccttggtttgctgtctgttcgtggaccgtctgctccacaaccc
gactcgcccgctgttcctcctctagacccctccacggctctaggcgttggcaacggcgtg
catccgcatctttctccgtccatgcctctgaaagttgaagagggtgtcatttcgaatatt
gcgtcatcgacgtcgatgccagcattgcgcgcttcctcagctggaatggcacctgatact
tggttcgcccccaatgctgggaatcaagttctgccaccttcctctggggcttttctcgag
cgcaccaccgctcctcccgtcttcacgtcggtagttccaagtaccatggttcctcgcatt
ttcgaagcagatccaggccttcccattcctgcttctcactcggttggttcgacaccgtca
agtgccccccctcataccccggcgctggcaaatgccgactcggtggcgccaccaacgact
cccctctctgtggctttcgggtccgttggggctcgcccgtttcccgacacactgccagta
gcctcagaggtggctattgcccgggtttcccctcagaatagctacacgacaggcagcact
ggcgtacatagcctgagtcaaaacggaagcactcccccagcctggcaaccaacggagaca
caacactctcttccagtgtatggaaacactctccctcccagaaatcatggtccggggatg
catagatctatttactcagcctcaggagacgtgtcgccaacatctggtattggcgtgaaa
ccattagtggggggggaaggtacgatatctcggctgagtgttgcgacagcacgggatcaa
gcgtttgcggcgtcaaccagtcccagactacccagtttgacacagacagctccaggctta
tctctcctggacgatgtccacgctcggacgggttcagcagctggttggggcagcaacatt
gcgggtgccggcactgtctcgtctttcagtatcccctcttcattgtatccggagtcaatt
cactccgtatcttccttccagggtccttcgtctctccacagtccagcatttgcgtcttcc
actctgggttcccctatttcttctggatcgccgcattctagcaccaagattcccacacca
ttaacaacgtccacaccttcgtcccctgcacactctgacacatcaggatcgttgtcgcca
gtgctggcatcgacaaccactgttttgcctgagcttccaaaacggacacaacagtcgatc
acaagtcatgacgtccatgaagttgctagatcatctcccggaatctcttccactactcca
gcggggttctactcgggttccgtcaacccgtcgtcctttagtactgaactgagtaacctc
gtgtattcatccacaacttcctcggcctttgacagtccagctggtacaacagtatcgtca
cgaggaggaaatcttggaggtgccagagcttcgcctgtctctattcctcgtggcccttct
tccctgtctcacccaggagccagcccttctctttctactccaggtgtttcagcaggtgcc
ggaatcaagacaagagaaggtgtgggatcgggaggcatagcagctgcaggatctgcagct
gctggagtgtcgcggcagttgcccggtgcggtgacggcaatgccggccattgttcagtca
gcagatcagctcttcactagcacttcgtcatttattggggtcggcaactcactgatcaag
agtttccccttcgaagaggctctcgagtggagccagcagaggaatgaagcgaggaaagaa
caaaaggagaagccgcccacgcacttgggacagccgtgggttcggtgcgtgagcagcggc
atgacttgctgcattcctcagaaagctgtcggcggagactggaagaagaagcctccgtac
ctaaacgaatctccagcagaaaatcgtgcgtgtcaagcgcatttcgttcccatgcagaac
gcggtctgcgcctccaccgcttacgaggtttcgaagaaggccattgccgagaaacaacaa
cgtagggacaaaaccaacaaagtggcacagggtgttggagcagctctcaagactacggcg
cttctaacccagcaaggctctgacgccatgcactctagccttgctggcatggagcgtgca
caaggggatcctgcagcccaggttcaggaaataagaggtggtgtaaaagcaattgccgac
ctcctcatgaaaaccagcgacacgagtcctgcaatgtcaatggtcaccaaagctctggat
gacctcgcttaccttcaaaagaagtga

DBGET integrated database retrieval system