KEGG   Toxoplasma gondii: TGME49_201670Help
Entry
TGME49_201670     CDS       T01093                                 

Definition
(RefSeq) DnaJ domain-containing protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 7894453
NCBI-ProteinID: XP_002367463
UniProt: S8GER5
Position
VIIa:3865091..3867853
Genome map
AA seq 920 aa AA seqDB search
MEVACGARQARAGSPGTQNSGHNPSTTVPSPSPDPSSSSPSPSCGAAADSDDPFGVRSAL
DRLRGLSWKSPFRRRSAASSFISAYLAFFFGGCFGLHWFHLACWPRWALRVFTLSGCGLY
SLCDFFLLPSAVRASQRRRQRAFVRAELVKRLQAAHRREESAAALSRLEKRAGATSGAAS
WTLGRSVSLQDLEAFQRGREVLRRQTENLRKQRDEVLRRVLQLSVRCGFRSPSCLGSPAV
KQRGEKEKLGGEETPHRLAGVSQTNVATCTSPEEKKETDEGQKVSAPVETLPEAVEAADN
VVEKSEQGRNDNEIRAGRDATMATLMISNTAPSPSSPSTAPSPSSPSTSPSPSSLSPSCS
ASVSAARLHSSGVSASSRFPSGALRPRLSVSERDIAVLLKEQEVGVEVCALPPVVSSTSF
ASQRGSKAFFFRHLSWLRGVLSFWASLMPWRLLFRGIYAHVLCSFVVDVVFCNAELSPLS
APISRLVFVLLHCLARAAVIFAANFSDLTDMPSPWLCSDLLMCVAASFGGSAVLLLGPEL
LHAVGAYVPIVDAHVRASFSAFFGEFSVLLSLPSVEAQARLPRVAREDFYASCHFANLVV
IGVSAYLAAAAHHDEPEEARKREVSFCRDVLALLAVLDREDREALEKKRSKELKPEFTEA
SASAGGGETTVCQDTVVGGNGPQETKEKKTGGGKDEGRGRFEEDPRMAALVAQAQRTYGA
TITQSPGDTRVQRVRECMLSALVWFFALAFLAVWVACLVLAASNVAARMEDKTAAKVFAF
VSGDTKNDPELGQLKAELSVLYKQFQALQKEKGFTGALSDIAAMLWSEAQEAMSEQRRKQ
KKEDDAYTLLGVQPSATAREIKMAYKQLARQHHPDVVAAASPEPLTPLEEARATEKMRKI
NEAYERLMRTHGGRGNLGRV
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggcctgcggcgcccgacaagcgagggccgggagccccggaacacaaaactcc
ggtcacaatccgtcaaccacggtaccttctccgtctcctgatccttccagctcgtcaccc
tctccttcctgcggtgcggcggcggactcggatgacccatttggtgtgcgttcggcactg
gatcgtttgcgtgggttgtcgtggaagtccccgttccgtcggcggtctgctgcttcgtct
ttcatctctgcgtacttggccttcttcttcggcggctgcttcggtctgcactggttccac
ctggcctgctggccacggtgggcgctgcgtgtcttcacgctctcggggtgtggactctac
agtctctgcgacttctttcttctcccgagcgccgtgcgagcatcgcagcgaaggagacag
agggccttcgtgagggcggaacttgtcaagcgcttgcaggccgcccaccgccgcgaggag
agtgcagcggctctctcccgcctggagaagcgagcaggcgcgacctccggggccgctagc
tggactctagggcgcagtgtctccctccaggacctcgaggcgttccagcgcggacgcgag
gtgcttcggcgacagaccgaaaacctccggaagcaaagagatgaagtgctcagacgcgtc
ttgcagctctctgtgcgctgtggctttcggagtccttcgtgtcttgggagccccgcagtg
aagcagagaggagagaaagagaagttggggggggaggagacacctcacagactggcaggc
gtttctcagacgaatgtcgcgacgtgcacatctcctgaagaaaagaaggaaacagatgaa
ggtcagaaggtttcggcgcctgttgaaactctaccagaagccgtcgaggctgctgacaac
gtggtagagaaaagcgaacaaggtcgaaatgataacgagatcagagcgggtcgagacgcg
acgatggcgactttgatgatatcaaacaccgctccttcgccttcgtctccttctaccgct
ccttcgccttcgtctccttctacctctccttcgccttcttctctttcgccttcttgctct
gcgtctgtgtctgctgctcgtctgcattcttcgggtgtctctgcgtcctcgcggttcccg
tcgggtgcgttgcgtccaaggctgtcggtgtcggagcgcgacatcgcggttcttttgaag
gagcaagaagttggagtggaagtctgtgcgcttccgccagttgtgagttcgacttcgttt
gcctcgcagaggggctcgaaggctttttttttcaggcacctttcctggctgcgcggggtg
ctgagtttctgggcgtccctgatgccctggcgactgctttttcgcggcatctacgcgcat
gtcctctgttccttcgtagtcgacgttgtgttctgcaacgctgagctgtcgcccctgagt
gcgccgatctctcgactcgtgttcgttcttctgcactgtctcgctcgcgcggccgtcatc
ttcgccgcgaacttctcggacctgaccgacatgccttctccctggctctgcagcgacctc
ctcatgtgcgtggctgcgtcgttcgggggctctgcagttctccttctcggccccgaactg
ttgcatgcagtcggtgcctacgtcccgatcgtcgacgcccacgttcgcgcgtctttctcg
gccttcttcggggagttctccgtcctgctgtcgctcccgagcgtcgaggcccaggcccgc
ctcccccgcgtcgcccgagaagacttctacgcatcttgtcactttgctaaccttgtggtc
attggcgtcagcgcatacctcgcagctgcagctcaccacgacgagccggaggaggccagg
aagcgggaagtcagtttctgcagggacgtgctggcgctgctggcggtgcttgaccgcgag
gaccgcgaagcgctcgagaaaaagcgttcgaaagaactgaagccggagttcaccgaggcg
agtgcgtctgctggcgggggcgagacgactgtttgtcaagacacggtggtggggggaaac
ggacctcaggagaccaaggagaagaaaacaggaggcgggaaggacgaagggcgagggcga
ttcgaagaagacccgcgaatggctgcgctggttgcgcaggcgcagcgaacctatggcgcg
acgatcacccagagtcccggggacactcgcgtccagagggttcgcgagtgcatgctgtcg
gctttggtctggttcttcgccctcgcgttcctcgccgtctgggtggcctgtctcgtgctc
gcagcctccaatgtggcagcacggatggaagacaaaaccgcggcaaaagtctttgcgttt
gtctctggagacacgaagaacgaccctgagctcgggcaactcaaggcggagctctctgtc
ctgtacaagcagtttcaggccctgcagaaggagaaggggttcaccggtgccctcagcgac
atcgctgccatgctgtggagcgaggcccaggaggcgatgagcgagcagaggcgaaagcag
aagaaagaagacgacgcttacacgctactgggtgtgcagccaagcgcgacggctagggaa
atcaaaatggcctacaagcaactcgcgagacaacaccaccccgacgtcgttgccgccgcc
tcccccgagccgctgacgcccctcgaagaggcccgcgctacggagaaaatgcgaaaaatc
aacgaggcctacgagcgactcatgcgcacccacggcggcagaggcaacctcggaagagtg
tga

DBGET integrated database retrieval system