KEGG   Toxoplasma gondii: TGME49_201680Help
Entry
TGME49_201680     CDS       T01093                                 

Definition
(RefSeq) eukaryotic initiation factor-3 subunit 10, putative
  KO
K03254  translation initiation factor 3 subunit A
Organism
tgo  Toxoplasma gondii
Pathway
tgo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    TGME49_201680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tgo03012]
    TGME49_201680
Translation factors [BR:tgo03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    TGME49_201680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 7894442
NCBI-ProteinID: XP_018637435
UniProt: S8GP08
Position
VIIa:join(3854159..3854277,3855094..3855236,3855470..3856283,3856862..3857086,3857731..3858114,3858740..3858963,3859422..3859666,3860171..3860336,3860904..3861160,3861548..3861652,3861988..3862397,3862551..3862560)
Genome map
AA seq 1033 aa AA seqDB search
MQSFQKPENALKRADELLSVGQQDAALKILHGAIGHRRFRSQGWDSVQETIMIRHVQLCV
DENKLRLARDGLHQYRIISQHANIQSLGKVIAELRSRAEQKLTQAKESAAGASASPKSAD
APVLPGQGLGDLDSVADSPEDLLLSTLQIEVRSAEARGIHQALRSVWDVYKMVLDLLRTT
PKLERVYHETARKAFLFCKENQRPQEFKRLCDVLRSHFALILKNRHKEDYESLMRPDLHL
ETRMQQLVVASELELWRECYATAEDLYSLGLHDYFLKALRTGQDLFHNSREKLMRWLAIY
YEKLSRVTWVAENYLFHALAWIKLLLHVKGFKKNASQEDLQAMASVAVLAVLSIPISGAE
KKPGDDAVTMGEGMNYGSLEQQKKLTMLLGHSTLPSREGLKAVLFTKDLVSLADENCQQL
LSLIESEFTPLKLCSLCQPLLDAVSANPLLEPYVYPLKRVIFHKLIFQLSRVYATLSIKH
FTTHICTASFLPWSHAEKLFVALVQEQQASSSSFGSASANSNANLSIRLDYASSAILFET
PDAAAANTLRHQLCNLAKQIDKAVHMICPGQSMEERMDRRRFLQELPARLEAETRRMAER
TRATHSRRLEKQEEQQKMEEERRRKEAEQRRVEEKQERERREEATRRREERRMQQEKIKQ
RSETAAQMLEEIKKLGTKASSNILIKGKQLGDINIDDVLQGNVDYDDLEKAQMMQLNQER
IARLRQRRQNFRRVCHFIRACREEELPLLIRWQEEQLARDTQILLDMQNRHEEEHKAAFE
AALEEKQIFEVVKEDKEKWVAEKIAVRQKDFEQQAQEQRERLLHVLRQAKIQRARARKEE
HLKKLKIEVERKRMEEEQKKYLEQLEKKRQEEEAKAKRLAEQAEKQRQRELEIEEKQRQL
DLEASAALRSAPRAAPASPQKVEGSISPASSVPPSAGDSWRKGDRTETARRRVPAQSQGR
GEQDEGFERWREGKVNSGNGNDEEKTRPRFRVAAAALSEHLSAGKEGRDEIQNGDAQKPE
DDGFTTVSRNRRK
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctttccagaagcctgaaaacgcgctcaaacgcgcggatgaacttctctctgtg
ggccaacaagacgccgccctcaaaattctccacggtgccattgggcatcgacgcttccgg
tctcaaggatgggacagcgtccaggagacgattatgattcgtcacgttcagctgtgcgtt
gacgagaacaagctgcgtctggctcgcgatggtctgcaccagtacaggatcatctctcag
catgccaacatccagtctcttggcaaagtgattgcggagctgcgcagccgcgcagagcag
aagctgacgcaggcgaaagagtcggcggcgggggcgtctgcgagtccgaagagcgcggac
gcgccggtgttgcctggacaaggtttgggcgatttggactcggtcgcggactctccggaa
gacttgctgctctcgaccctgcagatcgaggttcgctcggcggaggctcgcggcatccac
caggcgctccgcagcgtttgggacgtctacaagatggtgctcgatttgctgcgcacgact
ccgaagctcgagcgcgtctaccacgagactgcgcggaaggcctttctcttttgcaaggag
aaccagcgtccgcaggagttcaagcgcctttgcgatgtgctcagaagccacttcgctctg
attctgaagaaccgccacaaggaggactacgaatcgcttatgcgcccggatctgcatctg
gagacgcgcatgcagcagctggtcgtggcgtccgagctggagctctggcgcgagtgctac
gcgactgccgaggacctctactcgctcggcctccacgactacttcctcaaggctctccgc
acggggcaagacctcttccataacagtcgcgagaaactcatgcgctggctggccatctac
tacgagaagctcagccgcgtcacctgggtcgcagaaaactacttgttccacgctctcgcc
tggatcaagcttcttctccacgtcaaaggcttcaagaaaaacgcttctcaagaggacctt
caagccatggcctccgtcgccgtcctcgccgtgctctcgatccccatctctggagcagag
aagaagcctggcgacgacgccgtgacgatgggagagggcatgaactacggctctttggag
cagcagaagaagctgacaatgttgcttggtcactcgactctgccgtctcgggagggcctc
aaggctgtgcttttcaccaaggacctcgtctctctcgcggacgagaactgtcaacagctc
ctttccttgattgaaagcgagttcacgcctctcaagctctgctctctctgccagcctctg
ttggacgcggtgagcgcgaatccgttgctggagccctacgtgtatcccttgaagagggtc
atcttccacaagttgattttccagctttctcgcgtgtacgcgactctctcgatcaagcac
ttcacgacgcacatctgcacggcgtccttccttccctggtcgcacgcagagaagctgttc
gtagcgctcgtccaggagcagcaggcctcctcgagctccttcggatctgcgtccgcgaac
tcgaacgcgaatctgtctattcgactggactacgcgagcagcgcaattctcttcgagact
cccgacgcagcggccgcgaacacactccgacaccaactctgcaacttggcaaagcaaatc
gacaaggcggtgcacatgatttgccctggacagtcgatggaggagagaatggatcggcgc
cgattcctgcaggagttgccggcgcgtttggaggcggagacgcgacggatggcggagcgc
acgcgggccactcactcgcgtcgcctcgagaaacaggaggagcagcaaaagatggaagaa
gagcgaagaagaaaggaagctgagcaacgcagagtcgaagagaagcaagagcgcgagcgc
cgtgaagaggcgacgcgtcgtcgggaagagcgacgcatgcagcaggagaaaatcaaacag
aggagcgagactgctgcccaaatgttggaggagataaaaaagctgggcaccaaggcttcg
agcaatattctgattaagggcaaacaactaggagacattaacatcgacgatgttctgcaa
ggaaacgtcgactacgacgatctagaaaaagctcaaatgatgcaactcaaccaggagaga
attgctcgtctgcggcagagacgccagaacttccgtcgcgtttgtcacttcattcgcgca
tgccgcgaggaagagttgccgctcctcatcagatggcaagaagagcagttggcccgcgac
actcaaattcttctcgacatgcagaaccggcacgaggaagagcacaaggctgccttcgag
gcagcgctggaagagaagcagatcttcgaggttgtcaaggaagacaaggagaagtgggtt
gcggagaagattgcagttcgtcagaaggactttgaacagcaggcgcaggagcagcgcgag
cgtctcctccacgttctgcgacaggcaaagattcaacgcgcgcgtgctcgcaaagaggaa
catctgaagaaactcaaaatcgaagtcgaacgcaagaggatggaggaggaacagaagaag
tacctcgagcaactggagaagaaaagacaggaggaagaggcgaaggcaaaacgcctggct
gagcaggcagaaaagcaacgtcagcgcgaactcgaaattgaggagaagcagcgccaactg
gacctggaagcgtcagcggctctgcggagcgccccgcgcgcggcgcctgcgtctcctcag
aaggtcgagggatcgatctctccggcgagcagcgtccctccatctgcaggagactcgtgg
cgaaagggtgaccggactgaaaccgcccgtcgacgggtgcctgctcagagccagggtcgc
ggagaacaggacgagggcttcgagcgctggagagaaggaaaagtgaactctggaaacgga
aacgacgaagagaagacgcgacccagattccgagtcgcagccgctgcactgtctgaacac
ctctcagcgggaaaggaaggacgcgatgaaattcagaacggagatgcgcagaagcccgaa
gacgacggattcaccacagtgtccaggaaccgaagaaagtga

DBGET integrated database retrieval system