KEGG   Toxoplasma gondii: TGME49_201690Help
Entry
TGME49_201690     CDS       T01093                                 

Definition
(RefSeq) BT1 family protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BT1 MFS_1
Motif
Other DBs
NCBI-GeneID: 7894441
NCBI-ProteinID: XP_002367465
UniProt: S8F9H7
Position
VIIa:complement(3846962..3849466)
Genome map
AA seq 834 aa AA seqDB search
MSFHVATPSSPKCETAPDLFSLISSSNSLFTPSRYSSASSSSSSATSSASSSSCVCSPND
ARCLICGRSSPALSGVSEPFPALPCLLPASLCSSATSLVSTVVNCALPSREVSPESAGGK
RSCRGWFRCIWSACVRAPRSVCSTAFIRWVFSVLLLPATLCRSVRKAVGSRFFLLLISVY
LCLKGLVYSLSTAAMLPYFKGLGWQAAAYQQATAIVFVPWGMKGLVGTLADAIPLFGYRK
KYYMLIASVLGVGGVFGLCILPDEFAADRLWLVCLLLLLVQLQVATLDLMCEGKYSELMV
EVPDVGPAVVTFVNALISVGQATGKMVVGPVSDRLGTRPLFWLALPLAVSVFVPICLNYL
PEKKLDHADLQVLRRHLWAQKNVFVMGIALATASLGVAVVSLFEGQRILIIYSLCAGVAL
SLVCCLTLPKPIAHCNMYFFLDQVLHLNVAGALDFFYTASPACLPDGPHFDYTYYNTYAC
IAGAIGGVVVLVLFLKVLPQYSFRHILTTACLVRLGASLVDYALVSRLTTELHLSDKAVY
LVGDAVILVGANALSYMVGVMLISKLCPKHVEVTVYAILAGMGNMGSTLSTLLGVAAIKE
FRITSKAEESCDFSRMPQLISISNFILPSLCIPLCMTLLPNTAMNAPLPVTTELEETLEC
SCSFAQDAQSAEENGWRGGSEERAEDENSEGSDAECHGSGRANPNGDRESGYAEDRHTNG
NTQGNWRKRRARRHARNREKEDERSRLVDEGRTAVGGVACREGQGKDERPLRPREKRKEL
DVRQAPDEYENCRNVVPVVSMLAGTELVGVRCEERNTSKRVGNGEESSTEDGEG
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccatgtggcaacgcccagcagtcccaagtgcgagactgcgccggacctcttt
tctctcatttcttcttcgaattccctttttactccctctcgctactcatctgcatcttcg
tcctcctcgtctgctacctcttctgcttcgagttcttcgtgtgtgtgttccccgaacgac
gcgcgctgtctcatttgtggtcgttcttctcccgcgttatctggtgtgagtgagccgttc
cctgctcttccttgtttactaccggcatctctgtgttcgtctgctacgtctttggtctcg
acggtggtaaattgtgcattgccatcccgcgaagtctcccccgagtctgccggtggaaag
cgcagttgtcgagggtggtttcgctgcatttggtctgcctgtgtgcgtgcgcctcgctct
gtctgttcgactgccttcatccggtgggtgttttccgttttgcttctcccggccacgctt
tgccggtctgtccggaaggcggtaggatcgcgattctttctcctcctgatttccgtctac
ctctgcctcaaggggctggtctactcgctgagcacggccgccatgctgccgtacttcaag
ggattgggatggcaggcggctgcgtaccagcaagcaacagccatcgtgtttgttccctgg
ggaatgaaggggcttgttggaacgctggcggacgcgataccgctctttgggtaccgaaaa
aagtattacatgctcattgcttcggtcttgggagtgggtggcgtcttcggcctctgcatc
ctgccggacgagttcgccgcggaccgcctttggctggtctgtttgctgcttctccttgtg
cagctccaagtggccactctcgacctgatgtgtgagggcaagtactcagaactgatggta
gaagttccggatgtcggtcccgccgtcgtgacctttgtgaatgcgttgatttccgtcggc
caggcgaccgggaaaatggtcgtaggtcccgtgagtgacagactgggaacgcgcccgctc
ttctggctggcgctgccgctcgctgtttctgtcttcgttcccatctgcctcaactatctt
cccgagaaaaaactggaccacgcggaccttcaggtgctccggcggcatctctgggcacag
aaaaacgtctttgtcatggggattgcgctcgcgacagcgtcgctcggagtcgccgtggta
tcgctctttgagggccaaagaatcctcattatctatagcctgtgcgccggggtcgctctg
tcgctcgtctgctgcctcacgctacccaagccgatcgctcactgcaacatgtacttcttt
ctcgaccaggtcctgcacttgaatgtcgcaggcgccctcgacttcttctacacagcctct
ccagcttgtcttcccgacggtccccactttgactacacctactacaacacgtacgcgtgc
atagcgggggctattggcggggtcgttgtcctcgtgctttttctgaaagttcttccccag
tactcctttcgccacattctcacgacagcctgtctggtgagactaggcgcctcgctcgta
gactacgccctcgtttcccgcctcacgacggagctgcatctctccgacaaagcggtctat
ttggttggagacgctgtaattttagtgggcgcaaatgcgctgtcctacatggtcggcgtg
atgctgatttccaaactttgtccaaagcacgtcgaagtgacagtgtacgcgatcctcgcg
ggtatgggcaacatggggtcgactttgtcgactttgctgggagttgcagccatcaaagag
ttccgcatcacctcgaaggctgaggaatcgtgcgatttctcgcgcatgcctcaactcatt
tccatctcaaatttcattctgccttccttgtgcattccactctgcatgactctcctgccc
aatactgccatgaacgccccgctcccggtaacgaccgaactagaagaaacgctggagtgt
tcctgttctttcgcgcaagacgcccagagtgcagaagaaaacggatggcgaggagggagt
gaagagcgtgcagaagacgaaaacagtgaaggaagcgacgcggagtgccacggaagtggc
agagccaaccctaatggggaccgagaaagtgggtacgcagaagacaggcacaccaacggg
aacacacaagggaactggaggaaacgaagagcacgacgccacgcgagaaacagagagaag
gaagacgagcgaagcaggcttgtcgacgaaggtcgcacagctgtcggtggtgtggcatgt
agggaaggccagggaaaggatgagagaccgttacgacctcgagagaagcgcaaagagtta
gatgtgagacaggcaccagacgaatacgagaattgcagaaacgtcgtgcctgtcgtgtcc
atgttagctggaacggagttggttggggtgaggtgtgaagaaagaaacacatcgaaaaga
gtgggcaatggagaagaatcaagcaccgaagacggagagggataa

DBGET integrated database retrieval system