KEGG   Toxoplasma gondii: TGME49_201700Help
Entry
TGME49_201700     CDS       T01093                                 

Definition
(RefSeq) WD domain, G-beta repeat-containing protein
  KO
K14004  protein transport protein SEC13
Organism
tgo  Toxoplasma gondii
Pathway
tgo03013  RNA transport
tgo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    TGME49_201700
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TGME49_201700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tgo03019]
    TGME49_201700
   04131 Membrane trafficking [BR:tgo04131]
    TGME49_201700
Messenger RNA biogenesis [BR:tgo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     TGME49_201700
Membrane trafficking [BR:tgo04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    TGME49_201700
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    TGME49_201700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 7894429
NCBI-ProteinID: XP_002367466
UniProt: S8F6C0
Position
VIIa:complement(join(3840925..3841040,3841593..3842748,3843095..3843559,3844111..3844338))
Genome map
AA seq 654 aa AA seqDB search
MAAPATLSTFETSHAGCLHSVEFDFFATRLATASSDRTIRLWSLSTPEASTHAGEVAPKT
ATFLQELRGHEGPVWQVRWAHPSFGNLLASCGYDRRIIVWRQSAAAVPQGPQTRFAPTQS
LFTPVYTNEDHTASVNSIAFCPHEFGLHLAAGSSDGSVSVLSLSGDPGAPGAQAQLFWSR
KAFAAHFNGVNSVAWAPFMPAASQAGAPALMLATGGCDSQVRIWGLDPNSQEWQQLHQLT
DADPHTDWVRDVAFQPASASSLLLSSSRLLASCSEDGTVKLWVGEASTPSANPSATSYTW
SLLQTLRLHAPVWRVSWSVSGTILSVACGEKDVCLFRETVAGHWEKVSRLLGPDSLPQVA
PRPLPPAAAPGVPPTQPGQQTPQGPQLQTQAPQLQTQAPQLQPQAPQLQPQAPQLQPHGS
AAPLGAYPPSHPPSLSSSPPTHPAHGASHPPLSSFPSSHPSLPQNPAPGPLSATPPSTAA
TPRPLGPAAGQPPQGSPTPGVAFPAPGAPAYPGTPASAGLYGPPTPGVPGGAQSYPQPSF
AAPYPQGSAFPPAVQPAQTSLGGQQAPSPASFFPAGTAGSARPKPPAFYNIGAPEAGPTG
AAPPAAQPFFSGGQTPGAAPGLQPPTGFPRLPMAAPGAQAYAPRAPMYAPYKGN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccagcgacgctctccacctttgagacctctcatgccgggtgtctgcacagc
gtggagtttgacttctttgccactcgactggcgacggcgtcttcagaccgcaccatacgc
ctctggagtctatcgacccctgaggcctcaacgcatgccggagaagtcgctcccaagacc
gccactttcctccaggagctccgcggccacgaagggcccgtctggcaggttcgctgggcg
cacccgtcgttcgggaacttgctcgcgtcttgcggctacgatcgccgaatcatcgtctgg
cgacagagcgccgccgcggtccctcaaggcccccagacccgctttgcccccactcagagt
ctgttcacccctgtgtacacgaacgaagaccacacggcgtcggtaaactccatcgcgttc
tgtccccacgagttcgggctccatctggccgccgggagcagcgacggctctgtttcggtc
ctctcgctctctggggaccctggagccccgggggcgcaggcccagctcttctggagtcga
aaggccttcgccgcccacttcaacggagtcaacagcgtcgcttgggctccgttcatgcct
gcggcctctcaggctggcgctcccgccctcatgctcgccacgggtggatgcgacagccag
gtccgcatctggggcctggacccaaactctcaggagtggcagcagctgcaccagttgacg
gacgcggatccccacacggactgggtgagagacgttgctttccagcctgcctccgcctcc
tcgctgcttctctcttcctcccgtttgcttgcctcctgcagcgaagacggaactgtgaaa
ctctgggtgggagaggcctcgacgccctcagcaaacccctcagcgacttcatacacctgg
tccctgcttcagactctccgactgcatgcacccgtttggcgcgtctcttggagtgtctct
ggaacgattctctcagtggcttgcggcgagaaggacgtttgcctcttcagagagacagtt
gcaggtcactgggagaaagtctcgaggctcctcgggccggacagtctcccccaggtcgcc
cctagacccctgccgcccgcggccgcccccggggttccaccaacccagccaggtcaacaa
acgcctcaaggccctcagctccagacgcaggcccctcagctccagacgcaggcccctcag
ctccagccccaggcccctcagctccagccccaggcccctcagctccagccccatggctcg
gctgcgcccctgggtgcctatccgccttctcacccgccgtctctttcttcgtcaccaccc
actcaccctgcacatggagcttctcatccgcctctgtcgtctttcccttcctcgcatccg
tcgctgccgcagaatcctgcgcctggacctctttctgcgacaccgccctcgactgctgcg
accccgaggcctctggggcccgccgcgggtcagccaccccaagggtctccaaccccaggc
gtcgccttcccggctccaggggctccggcgtaccctggaacccccgcgtcggcgggcctc
tacgggcctccgacccccggggtcccgggcggcgcccagagctaccctcagccctcgttt
gccgcgccatacccccagggttctgcgtttcctccggcggtgcagcccgctcagacaagt
ctggggggccaacaggccccgagccccgcgtccttcttccccgcggggaccgctggatct
gcgagaccgaagccgcccgccttctacaacattggagcgccagaggcaggcccgacaggt
gcggcgcctccggcggcccagcctttcttctcaggtggacagacacccggcgcagcacca
gggctgcagccccccaccgggtttccgaggctcccgatggccgccccaggcgcccaggcg
tacgcgcctcgggcgccgatgtatgcgccttacaaaggaaactaa

DBGET integrated database retrieval system