KEGG   Toxoplasma gondii: TGME49_224490Help
Entry
TGME49_224490     CDS       T01093                                 

Definition
(RefSeq) polyprenyl synthetase superfamily protein
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
tgo  Toxoplasma gondii
Pathway
tgo00900  Terpenoid backbone biosynthesis
tgo01100  Metabolic pathways
tgo01110  Biosynthesis of secondary metabolites
tgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TGME49_224490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:tgo01006]
    TGME49_224490
Enzymes [BR:tgo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     TGME49_224490
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     TGME49_224490
Prenyltransferases [BR:tgo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   TGME49_224490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 7897661
NCBI-ProteinID: XP_002366124
UniProt: S8GET6
Position
X:join(3029064..3029666,3030410..3030527,3030731..3031118,3032002..3032414,3032919..3033001,3033496..3033594,3034072..3034226,3034605..3034686)
Genome map
AA seq 646 aa AA seqDB search
MVDAVSLVSCRARHSHSLFAFSLSRRSCIQKYRFFSYVKSFPSSLPSPSRSSSPFTLSPR
RRCLPPLVLPLEAAGHLAPALHSGSGISCPRSSSLSLSSSSPMRTPPSFSLSLPPAQPPS
LCFSPTSRLSAPVFPWSFSRQLSLATLAPLASVSPWKKAAALPKPDGAAAVSDERTSAER
ADALAGAWRASASHVEDRFKQAFPEVRGTLLNHIAGLDLPASLSARLLSYYARLLDYTCS
GGKLTRGILVLYAAAAASHAPVLPPPSPSPAAAPASSASSVSSSPCSSSLAESERVPGSA
LSPALPPSSFRCLAALGWCVELLQSCFLVMDDVMDHSLTRRGKQCWYRCDGIGVSNAVND
SLVLEAAVYRVLREYLGDHPAYAQLQDLLLGNTFTTLIGQHLDSEDALAALSEASQNLES
RQSEDNSSASSATAAGSSLLRDASLSDKDFTHHSYVSSSLSSSRSSPSLSASSLPSSEVL
AQKLADRQATVARLKTSHYSFYLPTALGMTYGGLTDPALMAQAKELCLAIGEYFQVQDDY
LDCFSDPKISGKIGSDIQEKKCCWLFVQAVRRASREDLAQLLRVYGQPEYVDWVKDLYRR
LDLTSLYFQYEEETLAKLRRSVSSFPHDGMKAFFGLVLGRLHKRQK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgcggtgtctctcgtgtcttgccgagctcggcacagtcactcgctcttcgcg
ttttccttgtctcgtcgctcgtgcatccagaagtaccgctttttctcctacgtaaagtct
tttccctcctctctaccttctccctctcgctcctcttcacccttcactctctctcctcgt
cgcaggtgtctccctcctctcgtcttgcccctcgaggctgcagggcatctcgcgcctgct
ctccactccggctctggaatcagctgtcctcgttcctcctctttgtctctctcgtcctct
tctcctatgcgtactccgccttctttttctctgagccttccgccagctcagccgccttct
ctgtgcttttccccaacctcccgcctctcagctcccgttttcccctggtctttctctcgc
cagctgtctctggcgaccttggcgccgctcgcaagtgtctccccctggaaaaaggcagcc
gcgcttcccaagcctgacggagccgcagctgtttccgacgaacggacttccgcagagagg
gccgacgcccttgcaggtgcctggagagcttcggcttcgcatgttgaggatcgatttaag
caggcattcccagaagtacgagggactctcttaaaccacatcgcaggcctggacctcccc
gcttctctctctgcccgtttgctgagctactacgcgcgtctcctcgactatacatgctcc
gggggaaaactcacgcgcggcatcctcgtcctctacgctgccgccgctgcatctcacgcc
cccgtacttccacctccgtctccgtctcctgctgctgctcccgcctcttctgcttcttct
gtctcttcttctccttgctcgtcgtctctggcggagtcagagcgtgtgcctggttctgcg
ctttctccggctcttccgccgtcgtctttccgctgtctggctgctctcggctggtgcgtc
gagctgcttcagtcatgctttttggtcatggacgatgtgatggaccattccctcactcgg
cgggggaaacaatgttggtatcgctgcgacggcattggcgtgagcaacgcggtgaacgac
tctctcgtccttgaggctgcggtctacagagttcttcgcgagtatctcggggaccacccg
gcgtatgcgcagctccaagatctcctccttggaaacactttcacaactctcattggccag
cacttggattccgaagatgcacttgcagctctcagtgaagcatcccagaatctggagagt
cgccagagcgaagataacagctctgcctcctctgcaacagctgcaggctcttccctgttg
cgtgacgcatccttaagcgacaaggactttacgcatcattcttatgtgtcttcttctctc
tcttcttcccgttcgtctccttctctctctgcttcctctcttccttcctcggaggttctg
gcgcagaagctcgcagatcgccaggcgacggttgcgcgtctgaagaccagccactactct
ttctacttgcccacggctctggggatgacttacggtgggctcacagacccggcactcatg
gcccaggcgaaggagctttgtctcgcaattggagaatactttcaggtgcaagatgactac
ctcgactgcttcagtgatccaaagatctccggaaaaatcggaagcgacatccaagagaaa
aagtgctgctggctttttgtccaggctgtgaggcgagctagccgcgaggacctggcacag
ctccttcgggtgtatggacaacctgagtacgtcgactgggtgaaagatctctaccgtcgt
cttgacttgacctccttgtattttcagtatgaggaagaaactctggcgaagctgagaagg
tcagtttcttcgttcccacatgacggcatgaaggccttcttcggcctcgtcctcgggagg
ctccacaaacggcagaaatag

DBGET integrated database retrieval system