KEGG   Toxoplasma gondii: TGME49_263520Help
Entry
TGME49_263520     CDS       T01093                                 

Gene name
SPM1
Definition
(RefSeq) microtubule associated protein SPM1
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STOP
Motif
Other DBs
NCBI-GeneID: 7897256
NCBI-ProteinID: XP_002365452
UniProt: S8F1Y1
Position
VIIb:join(498809..499296,499901..500155,500511..500823)
Genome map
AA seq 351 aa AA seqDB search
MSGGNSNTPKKLPSEEGSDYGYPQKPQKYLPKSEQAEPDYSACCKGNDAYKGASHGTVQF
SHPEEAQKYAGAAAGAETIQRGRERVAADRQPRAAGDVPARRLHLSDVDEAHRGQSPSRH
PGYCVEELCTCGMHKCIPSRAPVPFTGSTQYRQEFVPKPLPPPTQVSQVTLPPSLPFEAE
SSYRTEFVAKPLPPPAKFSEVKLPPTLPFHGESAYRTDYVPKPLPEVAKPVEVKLPPTLP
FNAQSCYRSEYVAKPLPPPVQTVEVKLPPSLPFEGSTHYRDEFQVKPLPPATKVTEVKLP
PSLPFDATSMYRSDYVAKSNPICPVSKLPQYPAATYPQNHVFWDPDTKQWY
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaggaaactcaaacacacccaagaagttgccgtcggaagagggctccgactac
ggctacccgcagaagccccagaaatacctgccgaagtcagagcaggcggaacctgactac
tcggcttgctgcaaaggcaacgacgcatacaagggcgcttcccacggaaccgtgcagttt
tctcacccagaggaagctcaaaagtatgccggtgccgcagcaggcgccgaaacaattcaa
cggggacgggagcgagtggctgctgacagacagccgcgtgctgctggtgacgtacccgcc
cgcagacttcacctgtccgacgtagacgaggcacacagaggccagtcgccctcgagacat
cctggctattgtgtcgaggaactctgcacatgtggaatgcacaaatgcattccctcccgg
gctccggttcccttcacgggtagcactcagtaccgccaggagtttgtaccgaagccgctg
ccgccacccacacaagtgtcgcaggtgacgctgcctccctcacttccttttgaagcggag
agcagctaccgcactgagtttgtcgcgaagcccctgccgccgccggccaagttctccgaa
gttaagctgccacccactctcccctttcacggcgagtctgcgtacagaacggactacgtt
ccgaaacctttgcccgaagtcgccaagcctgtggaagtgaagcttcccccgactttgccg
ttcaacgctcagtcttgctacaggagcgagtacgttgcgaagcccctgccgccgcccgtc
cagaccgttgaggtgaagcttcctccatccctgcctttcgagggatcgacccactaccgc
gacgaattccaggtcaaacctcttccgcccgccaccaaggtcaccgaagttaagcttccg
ccttccttgcccttcgacgcgacatcgatgtaccgttcggactacgttgcgaagtccaac
cccatctgcccagtgtcgaaacttccgcagtaccccgcggcgacttacccgcagaaccac
gttttctgggacccggacacgaaacagtggtactaa

DBGET integrated database retrieval system