KEGG   Toxoplasma gondii: TGME49_285850Help
Entry
TGME49_285850     CDS       T01093                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase, FKBP-type domain-containing protein
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
tgo  Toxoplasma gondii
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tgo03009]
    TGME49_285850
Enzymes [BR:tgo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     TGME49_285850
Ribosome biogenesis [BR:tgo03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    TGME49_285850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C PAT1
Motif
Other DBs
NCBI-GeneID: 7898138
NCBI-ProteinID: XP_002369223
UniProt: S8F5H8
Position
V:complement(join(2171665..2172702,2173190..2173425,2173726..2173738))
Genome map
AA seq 428 aa AA seqDB search
MALWGPVISLSSSSAAVSFNAEQGRLCFTGALLVPLHVKDGKDAVEPPPRVLLSVRTLRR
QVASPLMVLDGRRMQARCKLLFEEDAEFSAKLLSPGHTDKWGVQLLGDSAPHPCDCCDLS
EDESEEEEEEEEEEVTRLEGKKRKRSAVEEVEAGEVPTLIPATSVHQTAAKQRQEQRAKE
EATPAGKARKTDQGNPRFLVPTLSDPIASLPSLADQLSSSPREEETPVSKQKKLAGKTPE
SGSANKNAREQRVAASSSSGVPSQERHKEQPNKSSKDANASGVKDRKTQKRDEKQGAAQR
SPAVEGSAQLSVGSRVSLPSGVSYEVVCLPSGGSKGKKETASPGDRVSIQYKGLLAKNLR
RFDSGRIKFVLGRGEVIKGMELGVKGMQLGEARRLLIPSALGYGRRGAPPAIPPNSDLIF
ECRLMSLG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtggggtcctgtgatctctctttcctcctcgtccgccgctgtctccttcaat
gcggagcaaggacgtctgtgcttcactggggctttgctagttcctcttcatgtgaaggac
ggaaaagacgcggtcgagcctccgccacgcgttctcttgagtgtacgtacactccgtcgg
caggtcgcctcgcctcttatggttctcgacgggcgtcgcatgcaggcgaggtgcaaattg
ttgttcgaggaagatgcagagttctcggcaaagctgttgtctcctggacacacagacaag
tggggtgtccagctcctaggagactcggctcctcatccatgcgactgctgtgacctcagt
gaagacgagtctgaagaagaagaagaagaagaagaagaagaagtgacaaggctcgaaggg
aagaagagaaagaggagtgctgtggaggaggttgaagccggcgaggtacctacgctgatt
ccggcgacttctgtgcaccagacggcagcgaaacagagacaagagcagagagcgaaggaa
gaggcaactccggcagggaaagcgaggaagacagaccaaggaaacccacggtttctcgtc
ccaacgctgtcagatcccattgcctctctgccttctctcgccgaccaactttcgtcttcg
ccgcgagaagaagagacacctgtctcgaagcagaagaagctcgcgggcaagacgccggag
tctggaagcgcgaacaagaacgcgcgagagcagcgggtcgcagccagcagttcctctgga
gttccctcacaagagagacacaaagagcagccgaacaagagttcgaaggacgcgaacgca
tcgggtgtgaaagaccggaagacccagaaacgagacgaaaaacagggtgcagcgcaaagg
agccctgcggtagaggggtccgcccaactgagcgtaggaagccgtgtgtctctgccttct
ggagtctcctatgaggttgtgtgtcttccctcgggcggttcaaaggggaagaaagagacg
gcgagtcctggggaccgtgtgtcgatccagtacaaaggactgctggcaaagaatctccga
cgcttcgatagtgggagaatcaagttcgttctcggaagaggcgaagtcatcaaaggcatg
gagctcggcgtcaagggcatgcagttgggagaggcgcgcagactcctcatccccagcgct
ctagggtatggcagacgcggagcgcctcccgcaatcccgcccaacagtgacctcatcttc
gagtgtcgactgatgagtctcgggtga

DBGET integrated database retrieval system