KEGG   Toxoplasma gondii: TGME49_309752Help
Entry
TGME49_309752     CDS       T01093                                 

Definition
(RefSeq) succinate-Coenzyme A ligase, beta subunit, putative
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
tgo  Toxoplasma gondii
Pathway
tgo00020  Citrate cycle (TCA cycle)
tgo00640  Propanoate metabolism
tgo01100  Metabolic pathways
tgo01110  Biosynthesis of secondary metabolites
tgo01130  Biosynthesis of antibiotics
tgo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TGME49_309752
   00640 Propanoate metabolism
    TGME49_309752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgo04147]
    TGME49_309752
Enzymes [BR:tgo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TGME49_309752
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TGME49_309752
Exosome [BR:tgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TGME49_309752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 OKR_DC_1_N Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 7900280
NCBI-ProteinID: XP_002364222
UniProt: A0A125YHZ4
Position
XI:join(787257..787897,788337..788419,789050..789627,790286..790480)
Genome map
AA seq 498 aa AA seqDB search
MALSAAGVGRQVLSAAARLSCSTSSAPLRATISSVTAASATSSSLLPSLLCATHRATGAT
SPSHQREQRRFLNLHEYQSMRIMKEFHITTPKFAVASTAKEAEQEAATFLSESPSGDGEP
VDFVVKAQVLAGGRGLGFFRENGYQGGVQVCESPREVGIVAEKMLGKTLVTKQTGKEGKL
CNKVLVTERFFIRKEKYVAILMDRGAGGPILIGSARGGTSIEDIAHNYPESIHKMPIDIN
QGISEPRLREFAELLGFSGDRLEAACQCIRGLYELFRSKDCTQIEVNPLVETHDGRVLVC
DAKLNFDDNAGFRQKDIFSQRDYSQEDPREVAADAADLNYIGLEGSIGCMVNGAGLAMAT
MDIIHLHGGSPANFLDVGGGADQHQIIEALKIIQQDKRANCVLVNIFGGIMRCDVIAKGL
VAAAKEVGFDKPVVLRLEGTNKEAAKEVLKDVLTDPAYSALQLLQEDDFDKAAQLAVKVA
SVVDAAAKANLKVHISAP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctcagccgctggcgtcggccggcaggttctctctgccgccgcgcgtctgtct
tgttccacttcttctgcccctctacgcgcgacgatttcttctgtcacagctgcttccgcc
acgtcttcctctctgcttccctcccttttgtgtgccactcaccgcgcgaccggcgcgacc
tcgccttcccaccagcgcgagcagcgccggttcctgaacctgcacgagtaccaaagcatg
agaatcatgaaggagttccacattaccacgcccaagttcgccgtcgcttcaacagcgaag
gaggccgagcaggaagccgcgactttcctgtccgagtcgccgagcggcgacggggagccc
gtggactttgtcgtcaaggcgcaggtcttggctggcggcaggggcctcggcttcttcaga
gagaacgggtaccagggcggcgtccaggtctgtgagagtccccgcgaggtcggcatcgtt
gcggaaaaaatgctcgggaaaacgctcgtcaccaagcaaacaggaaaggaaggcaagctg
tgcaacaaagtcctcgtcacagagcgattcttcatccggaaagaaaaatacgtcgccatc
ctcatggaccgcggcgccggaggtcctatcctcattggaagcgctcgaggaggcaccagc
atcgaggatatcgcccacaactacccggagtccattcacaaaatgccgatcgacatcaac
caaggaatctctgagccgcgtttgagggagtttgcggagttgctgggcttttctggagac
cggctggaggcggcgtgccagtgcatccgtgggctgtacgagctgttcaggagcaaggac
tgcacgcagattgaagtgaatcctctggtggagacgcacgacggccgcgtgttggtgtgc
gacgcgaaactcaacttcgacgacaacgcgggtttccgacagaaagacattttctctcaa
cgcgattactcccaagaagacccgcgagaggtggcggccgacgccgcagatctgaactat
atcggcctcgaggggagcatcgggtgtatggtcaacggcgccggtctcgccatggccacc
atggacatcatccaccttcacggaggctctcccgcgaactttctcgatgtcggcggcggg
gccgaccaacaccagatcatcgaggccttgaaaatcatccagcaggacaagcgagcgaac
tgcgtcctcgtcaacatctttggcggcatcatgcgatgcgatgtcattgccaagggcctc
gtcgccgccgcgaaggaagtcggattcgacaagccagtcgtgcttcgacttgaaggcacg
aacaaggaagcagctaaggaagttctgaaagacgttctcacggacccggcgtactcggcg
ctccagctcctacaggaggatgacttcgacaaagcggcgcagcttgcggtgaaagtggca
agcgttgtggatgcggcagcaaaggcgaacctgaaggttcacatttcggcgccgtaa

DBGET integrated database retrieval system