KEGG   Toxoplasma gondii: TGME49_321500Help
Entry
TGME49_321500     CDS       T01093                                 

Definition
(RefSeq) RNA recognition motif-containing protein
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
tgo  Toxoplasma gondii
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tgo03041]
    TGME49_321500
Spliceosome [BR:tgo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TGME49_321500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1 WW RRM_7 BRAP2 RRM_5 RNA_bind
Motif
Other DBs
NCBI-GeneID: 7896784
NCBI-ProteinID: XP_018638402
UniProt: S8FBK6
Position
Ib:join(1764448..1764703,1765150..1765584,1765820..1766149,1766429..1766835)
Genome map
AA seq 475 aa AA seqDB search
MEGAIPQAGEMENGATVGAPVSGVPRPAGHMAPRVEIKLFVGRVPQSMEDAALRPIFEEF
GEVKEAVIIRDKATGKHKNSAFIKMDSIAAADAAIRGLNSTRILEQSMGPITVKYATGEA
EKLGFATSSCEPGQDQAKLFIGSIPRTMTEDEVRQFFSTYGTVEEVFVMKDNVQNTGKGC
CFVKFAFKEEALHAVRTLSGKHTFEGCTRPVEVRFAESKAARQQQMMNQQAMGGPQGMRG
PGRMGNMGGMGASNMGGMGGPAMGMGSSTQMGTPNNSNPRAAGQWKEYFTQDGRAYYHNE
YTNVTTWDRPQEFYQLPPAPPHMGGAGGMAAGSGQSSNAEGPPGANIFVFHVPNEWTYYD
LMQNFGGFGNVVSARVATDRTTGRNRGFAFVSYDNVESAATAVNNMNGFMAGGKRLKVSV
KKGEEQYVQHLLQPQNNPQGPRGNAGGMQQQWGSGYSQGGGVYGGSGGQQRFTPY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgcaattccacaggcaggcgaaatggagaacggcgcgacggtcggcgccccc
gtgagcggcgtaccccgtcctgctggccacatggcgccgcgcgtcgaaatcaagttgttc
gttggccgcgttcctcagtcgatggaagacgccgcgttgcgcccgatcttcgaggagttc
ggtgaagtcaaggaggcggtgatcatccgcgacaaggcgactggcaagcacaagaacagc
gccttcatcaaaatggactcgattgctgctgccgacgcggcgattcgcggcctgaacagc
actcgtattttggagcagagcatgggtccgatcaccgtcaagtacgccacaggcgaagcc
gagaagctaggttttgcaacttcatcctgcgaacccggtcaggatcaggcgaagctcttt
atcggctcgattccccggacgatgactgaagacgaggtgcgccagttcttctccacctac
ggaactgtcgaggaggttttcgtcatgaaggacaacgtgcagaacaccggcaagggctgc
tgctttgtcaagtttgccttcaaggaggaggctctgcatgcagttcgcactctcagcggc
aaacacaccttcgagggatgcacccgccccgtcgaagtccggttcgcagagtcgaaggct
gcccgacagcagcagatgatgaaccaacaagccatgggaggcccgcagggcatgcgcggt
ccgggtcgcatgggcaacatgggcggcatgggcgccagcaacatgggtggcatgggcggt
cctgctatgggcatgggcagcagcacgcagatgggtactccgaacaacagcaatccgcga
gcagctggtcagtggaaggaatacttcacgcaagacggtcgcgcgtactaccacaacgag
tacaccaacgtcaccacttgggatcggccccaggagttctatcaactccctcccgcgcct
ccgcacatgggcggcgccggcggaatggctgccggctctggacagagcagcaacgctgaa
ggtccccccggcgcgaacatttttgtgttccacgtcccgaacgagtggacttactacgac
ttgatgcagaactttgggggcttcggcaacgtggtgtctgcccgtgtggcgacggacaga
acgactggcaggaaccgaggattcgccttcgtctcctacgacaacgtggagtcggccgcg
accgccgtgaacaacatgaacggcttcatggctggcggcaagcgcctgaaggtgtctgtg
aagaagggggaggagcagtacgtccagcacctgcttcaaccccagaacaacccgcagggc
cctcgcggcaacgccggtggcatgcagcagcagtggggaagcggctacagccagggtgga
ggcgtctatggcggcagcggaggccaacagcgcttcacgccttactag

DBGET integrated database retrieval system