KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0133Help
Entry
Tgr7_0133         CDS       T00840                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00780  Biotin metabolism
tgr01100  Metabolic pathways
Module
tgr_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tgr7_0133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tgr01007]
    Tgr7_0133
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Tgr7_0133
Amino acid related enzymes [BR:tgr01007]
 Aminotransferase (transaminase)
  Class II
   Tgr7_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACL71236
UniProt: B8GTH6
Position
142453..143631
Genome map
AA seq 392 aa AA seqDB search
MRDLKTELEQRRAKGLYRSRRVLEGRQTPEQVVDGRQVIAFCSNDYLGLASHPKVIAALR
KGASEYGAGAGAAHLVNGHTRAHHQLEEELAAFTNRERALLFSTGYMANLGVAQALLGRS
DHVLEDRLNHASLIDAGLLSGARFQRYRHATAVDLAQRLAGLGQTGERLVLTDGVFSMDG
NLAPLPELASICTAHQAWLLVDDAHGLGVLGETGAGSLEHFGLSQQQVPILMGTLGKAFG
TAGAFVAGSEALIETLIQSARTYVYTTAMPAAMAEATRAALRIVQAEGKRREKLRSLVAR
FRAGAGQLGVRLMDSQTPIQPLVIGDAVEALRLSERLLEQDLLVPAIRPPTVPEGTARLR
VTLSAAHTEAQVDRLLEALDRSMRGSEDVGSR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacctgaagacggaactggagcagcgccgcgccaaggggctgtaccgcagtcgc
cgggtgctggaggggcgccagacaccggaacaggtggtggacgggcgccaggtgatcgcc
ttctgttccaacgactacctggggcttgccagtcatcccaaggtgatcgccgccctgcgc
aagggggcctcggaatacggcgcgggtgccggcgcggcccacctggtcaatggccatacc
cgggcacatcatcaactggaagaagagcttgcggcattcacgaaccgcgaacgtgcgctg
ctgttctccaccggctacatggccaacctgggcgtggcccaggccctgctggggcgcagc
gaccacgtgctggaggaccggctcaaccacgcctccctgatcgatgcgggcctgctctcc
ggggcccgtttccagcgctaccgccacgccaccgccgtggacctggcccagcggctggcg
ggcctgggccagaccggtgagcgcctggtgctcaccgacggggtgttcagcatggacggc
aacctggccccactgccggaactggcgagtatctgcaccgcccaccaggcctggctgctg
gtggacgacgcccacggcctgggggtactgggggagaccggggccggcagcctggagcac
ttcggactgagccagcagcaggtgccgattctcatgggcaccctgggcaaggccttcggg
accgccggggccttcgtggcgggcagcgaggccctgatcgagaccctgatccagtccgcc
cgcacttacgtttacaccaccgccatgcccgccgccatggccgaggccacccgggcggca
ctgcggatcgtgcaggccgagggcaagcgccgggagaagctcagatcgctggtggcccgt
ttccgtgcgggcgccgggcagctgggtgtgaggctcatggacagccagacccccatccag
cccctggtgatcggcgatgcggtggaggcactgcggctgagcgagcggctgctggaacag
gacctgctggtgcccgccatccgcccgcccacggtgcccgagggcaccgcccgcctgcga
gtgaccctgagcgctgcccacacggaggcgcaggtggatcggctgctggaggccctggat
cgatcgatgcgggggagtgaagacgtcggcagtcgctga

DBGET integrated database retrieval system