KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0872Help
Entry
Tgr7_0872         CDS       T00840                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00030  Pentose phosphate pathway
tgr00480  Glutathione metabolism
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Module
tgr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tgr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tgr7_0872
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tgr7_0872
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgr04147]
    Tgr7_0872
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Tgr7_0872
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Tgr7_0872
Exosome [BR:tgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tgr7_0872
  Exosomal proteins of colorectal cancer cells
   Tgr7_0872
  Exosomal proteins of bladder cancer cells
   Tgr7_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACL71963
UniProt: B8GNA2
Position
complement(939186..940667)
Genome map
AA seq 493 aa AA seqDB search
MTDACTFVIFGATGNLAQNKLLPALYHLEEAGRLPDKAVVLGVGRRDWDDEAWRREVEDT
LAPRARNGGLDKAVFKRFRQRLYFSPGDLNDKATYQALRERIEHSTELPENVIFYMAIRP
AEFGTVSANLAKVGLHKQTNGWRRLVVEKPFGYDLESAQILDDRLHRHFTEEQIFRIDHY
LGKGTIQNILVFRFANLLLEPLWNRNYIDHVQISHAEARGIEGRADYYDGAGALRDMIQS
HLLQMLTLVAMEPPALLDGEALRDEKVKVLRSIRPIPQSAVHAHAFRAQYTRGQRGGEKL
PGYLEEKAVPANSTTETFAALKLYIDNWRWRNVPFYLRTGKAMERNSSMVSIRFKHPPQQ
LFRETAIESLKPNWILMGIQPDECLRIELQVKQTGLEMRSRTTQLDASYCRADEVKLDAY
EALLLDVIDGDHALFLRYDEVEWAWRVVDPVLKLWSVERDFIHTYPAGSWGPQEANRLFD
RDDQRWRDSVDAD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctgcaccttcgtgatcttcggcgccacgggcaacctggcccagaacaag
ctgctgcccgccctgtatcacctggaagaggcgggccggctgccggacaaggcggtggtg
ctgggcgtgggccggcgcgactgggatgacgaggcctggcgccgcgaggtggaagacaca
ctcgccccgcgggcgcgcaacggcggtctggacaaagcggtgttcaagcgctttcgccaa
cgcctctatttcagccccggcgatctcaacgacaaggccacctaccaggccctgcgcgag
cgcatcgagcacagcaccgaactgccggagaacgtgatcttctacatggccatccgcccg
gcggagttcggcaccgtgagcgcgaatctggccaaggtgggcctgcacaagcagaccaac
ggctggcgccgcctggtggtggaaaagcccttcggctacgacctggagagcgcgcagatc
ctggacgaccggctgcaccggcatttcaccgaggagcagatctttcgcatcgaccactac
ctgggcaagggcaccatccagaacatcctggtgttccgcttcgccaacctgctgctggaa
cccctgtggaaccgcaactacatcgaccacgtgcagatctcccacgccgaggcccggggc
atcgaggggcgcgccgattactacgacggtgccggcgccctgcgcgacatgatccagagc
cacctgctgcagatgctcaccctggtggccatggagccgccagcactgctggacggcgag
gccctgcgcgacgagaaggtgaaggtgctgcgctccatccgccccatcccccagagcgcc
gtgcatgcccacgccttccgcgcccagtacacccggggacagcggggcggcgagaagctg
ccaggctacctggaggagaaggccgtgccggccaacagcaccaccgagaccttcgcggcg
ctcaagctctacatcgacaactggcgctggcgcaacgtgcccttctacctgcgcaccggc
aaggccatggagcgcaacagctccatggtcagcatccgcttcaagcacccgccccagcag
ctgttccgcgagaccgccatcgagagcctcaagcccaactggatcctcatgggcatccag
ccggacgagtgcctgcgcatcgagttacaggtcaagcagaccggcctggaaatgcgctcc
cgcaccacccagctggacgcgagctactgccgcgccgacgaggtgaagctcgacgcctac
gaggccctgctgctggacgtgatcgacggcgaccacgctttattcctgcgctacgacgag
gtggaatgggcctggcgggtggtggacccggtgctcaagctctggtccgtggagcgcgac
ttcatccacacctaccccgccggcagctggggcccccaggaggccaaccgcctgttcgac
cgcgacgaccagcgctggcgggattcagtggatgcggattaa

DBGET integrated database retrieval system