KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0903
Entry
Tgr7_0903         CDS       T00840                                 

Definition
(GenBank) Adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00230  Purine metabolism
tgr00250  Alanine, aspartate and glutamate metabolism
tgr01100  Metabolic pathways
Module
tgr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tgr7_0903
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tgr7_0903
Enzymes [BR:tgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Tgr7_0903
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-ProteinID: ACL71994
UniProt: B8GND3
Position
973889..975181
AA seq 430 aa
MGKFAVVLGSQWGDEGKGKVVDLLTENAAAVVRFQGGHNAGHTLVIDGKKTVLHLIPSGI
LREGVECMIGNGVVLSPEALMKEMAQLEAEGVPVRDRLRLSESCQLILPYHVSLDLAREQ
ARGKAAIGTTGRGIGPAYEDKVSRRGLRLGDLFHRERFAAKLGEVLDYHNFVLQHYFKSE
AVDFQQVLDQSLALAETLQPLVMDVPERLRELRAQGANVMFEGAQGTLLDIDHGTYPFVT
SSNTTAGGACTGSGVGPLDLDYVLGITKAYTTRVGAGPFPTELFDAMGEHLARRGHEFGS
TTGRARRCGWFDAVALRRAVAINSISGLCVTKLDVLDGLETLQLCVGYRCGDAEFSVPPA
GADAFATCEPIYEEMPGWQESTLGVTRREDLPVNALRYLERIQEIIGVPVDMISTGPDRD
QTIVLRHPFE
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgggcaaattcgcagtggttctcggtagccagtggggtgacgagggcaaaggcaaggtg
gtggacctgctgacggagaacgccgccgcggtggtgcgtttccagggcggtcacaacgcg
ggccacaccctggtgatcgacggcaagaagaccgtgctgcatctcatcccctccggcatc
ctgcgcgagggtgtggagtgcatgatcggcaacggcgtggtgctctcccccgaggccctg
atgaaggagatggcccagctggaggccgaaggcgtgccggtgcgcgatcgcctgcgcctg
tccgagtcctgccagctgatcctgccctatcacgtgagcctggacctggcccgtgaacag
gcccggggcaaggccgccatcggcaccaccggccggggcatcggccccgcctacgaggac
aaggtctcccgccgcggcctgcgcctgggcgacctgttccaccgggagcgcttcgccgcc
aagctgggcgaggtgctggactaccacaacttcgtgctgcagcactatttcaagagcgag
gcggtggacttccagcaggtgctggaccagtccctggccctggccgagaccctgcagccc
ctggtcatggacgtgcccgagcgcctgcgcgaactgcgcgcccagggcgccaacgtgatg
ttcgagggcgcccagggcaccctgctggacatcgaccacggcacctatcccttcgtgacc
tcctccaacaccaccgccggcggtgcctgcaccggcagcggcgtgggcccgctggatctc
gattacgtgctgggcatcaccaaggcctacaccacccgggtgggcgccggcccgttcccc
acggagctgttcgatgccatgggcgagcacctggcccgccgcggtcacgagttcggttcc
accaccggacgtgcccggcgctgcggctggttcgacgccgtggccctgcgccgcgctgtg
gccatcaacagcatcagcggcctgtgcgtcaccaagctggacgtgctggacggcctggag
accctgcagctgtgcgtgggctatcgctgcggtgacgccgagttcagcgtgccccccgcc
ggtgccgacgccttcgccacctgcgaacccatctacgaggagatgcccggctggcaggag
tccaccctgggcgtgacccgccgggaggatctgcctgtgaatgccctgcgttacctggag
cgcatccaggagatcatcggcgtgcccgtggacatgatctccaccggccccgaccgggat
cagaccatcgtcctgcgtcatcccttcgagtga

DBGET integrated database retrieval system