KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0974
Entry
Tgr7_0974         CDS       T00840                                 

Definition
(GenBank) Dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00261  Monobactam biosynthesis
tgr00300  Lysine biosynthesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01230  Biosynthesis of amino acids
Module
tgr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
tgr_M00526  Lysine biosynthesis, DAP dehydrogenase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Tgr7_0974
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tgr7_0974
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     Tgr7_0974
SSDB
Motif
Pfam: DapB_C DapB_N Sacchrp_dh_NADP Semialdhyde_dh
Other DBs
NCBI-ProteinID: ACL72062
UniProt: B8GNX3
Position
1052401..1053204
AA seq 267 aa
MTNICIVGAGGRMGRTLIEAIQQAEGLDLTVATERAGSSLIGADAGELAGVGRLGVAISE
DPAAQVAAFDVLIDFTRPEGTLAHLEICRKAGRAMVIGTTGFTEAQKQTIREAAKEIPVV
FAPNMSVGVNLCLKLLDLAARVLGDEVDIEVIEAHHRHKVDAPSGTALRMGEVVAEALGR
DLAQCAVYGREGHTGERERKTIGFETIRAGDIVGEHTVMFAGIGERVEITHKASSRMTFA
KGAVRAAAWLKGRSAGLYDMQDVLDLR
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaccaacatctgcatcgtcggcgccggtgggcgcatggggcgcaccctgatcgaggcc
atccagcaggccgagggccttgatctcaccgtggccaccgagcgggccggcagttccctg
atcggcgccgatgcgggcgagctggcgggcgtgggccgcctgggggtggccatcagcgag
gatccggccgcccaggtggcggcctttgacgtgctcatcgacttcacccgcccggaaggc
acgctcgcgcatctggagatctgccgcaaggcgggccgggccatggtgatcggcaccacc
ggcttcaccgaggcgcagaagcagacgatccgcgaggcggcgaaagagatccccgtggta
ttcgcccccaatatgagcgtgggcgtgaacctgtgcctcaagctcctggacctggccgcc
cgggtgctgggcgacgaggtggacatcgaggtgatcgaggcccaccaccgccacaaggtg
gatgcaccctccggcaccgcgcttcgcatgggtgaggtggtggccgaggccctggggcgg
gatctggcccagtgcgccgtctacggccgtgaaggccacaccggcgagcgggagcgcaag
accatcggtttcgagaccatccgcgccggcgacatcgttggcgaacacacggtcatgttc
gctggcattggcgagcgggtggagatcacccacaaggcctccagtcgcatgaccttcgcc
aagggcgcggtgcgcgccgccgcctggctgaagggccggtccgccggcctctacgacatg
caggacgtgctcgacctgcgctga

DBGET integrated database retrieval system