KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0982Help
Entry
Tgr7_0982         CDS       T00840                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00790  Folate biosynthesis
tgr01100  Metabolic pathways
Module
tgr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tgr7_0982
Enzymes [BR:tgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Tgr7_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACL72070
UniProt: B8GNY1
Position
1062564..1063400
Genome map
AA seq 278 aa AA seqDB search
MLDCGGRALDLSRPRVMGILNVTPDSFSDGGRHAGLQQAVDHALAMVEAGAAIIDVGGES
TRPGAEPVPVEEELARVIPVVEALARAIPVPVSVDTSQPEVMRAAAGAGAGLINDVRGLR
LPGALEAARDIGLPVCLMHMSTLDPRTMQQEARYGDVVAEVGAFLAERVQACEALGIGRE
RLVLDPGFGFGKTLDHNLALFRALPELASLGLPLLVGVSRKGMIGALLGDRPIDGRLHGS
VAAALLAARAGARILRVHDVGPTVDALRMLEGLEARGG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctggactgtggtgggcgagcgctggatctatcgcgcccgcgggtgatggggatcctc
aatgtgaccccggattccttctctgatggcgggcgccatgccggcctgcagcaggctgtg
gaccatgccctggccatggtggaggcgggtgcggccatcattgacgtgggtggggagtcc
acccgtccaggcgctgagccggtaccggtggaggaggagctggcgcgggtcattccggtg
gtcgaggccctggcccgggccatcccggtgcccgtctccgtggacaccagccagccggag
gtgatgcgtgccgcagccggggccggggcggggctgatcaacgacgtgcgtggcctgagg
ctgccgggcgccctggaagcggcccgggacatcggcctgcccgtgtgtctcatgcacatg
agcaccctggatccgcgcaccatgcagcaggaagcccgctacggggacgtggtggccgag
gtcggggcctttctcgccgagcgggtgcaggcctgcgaggccctgggtatcggccgggag
cgcctggtgctggacccgggatttggctttggcaagaccctggatcacaatctggccctg
tttcgcgccctgccggaactggcatccctgggcctgcccctgctggtgggggtctcgcgc
aagggcatgatcggtgcgctgctgggcgatcggcccatcgacgggcgtctgcatggcagc
gtcgcggcggccctgctggctgcccgggccggtgcccgcatcctgcgggtccatgacgtg
gggcccacggtggatgccctgcgcatgctcgagggcctcgaggcccgggggggctga

DBGET integrated database retrieval system