KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1514Help
Entry
Tgr7_1514         CDS       T00840                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00071  Fatty acid degradation
tgr00280  Valine, leucine and isoleucine degradation
tgr00310  Lysine degradation
tgr00362  Benzoate degradation
tgr00380  Tryptophan metabolism
tgr00620  Pyruvate metabolism
tgr00630  Glyoxylate and dicarboxylate metabolism
tgr00640  Propanoate metabolism
tgr00650  Butanoate metabolism
tgr00900  Terpenoid backbone biosynthesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
tgr01212  Fatty acid metabolism
tgr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tgr7_1514
   00630 Glyoxylate and dicarboxylate metabolism
    Tgr7_1514
   00640 Propanoate metabolism
    Tgr7_1514
   00650 Butanoate metabolism
    Tgr7_1514
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tgr7_1514
   00072 Synthesis and degradation of ketone bodies
    Tgr7_1514
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tgr7_1514
   00310 Lysine degradation
    Tgr7_1514
   00380 Tryptophan metabolism
    Tgr7_1514
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tgr7_1514
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tgr7_1514
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tgr7_1514
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgr04147]
    Tgr7_1514
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tgr7_1514
Exosome [BR:tgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tgr7_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACL72598
UniProt: B8GRP4
Position
1625626..1626810
Genome map
AA seq 394 aa AA seqDB search
MSDSVVIVEAVRTPVGNFNGALAGIPASELGARVIRALLERSGVSGDQIGEVILGQVLQA
AAGQNPARQAALAAGLPVSVPAMTINKVCGSGLKAVHLAWQAVRCGDAEVVIAGGQENMS
MAPHVLPGSRVGKKMGGWELVDTMITDGLWCAFNNCHMGNTAENIAKQFEIGRADQDAFA
AESQQRAERAQKAGVFRDEIVPVEIPQRKGDPIVFDTDEFPRHGTTAQTLAGLRPAFDKE
GSVTPGNASGINDGAAVVMVMSESRAKALGLKPLARIVSFAATGVDPAIMGTGPIPATTK
CLERAGWKPSDLDLVEANEAFAAQAIAVNRSLGWDLSRVNISGGAIALGHPIGASGARVL
VTLLHGMKRTGARKGLATLCIGGGQGVAMAVEGL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattccgtcgtcatcgtcgaggccgtgcgaacccccgtaggcaacttcaacggt
gccctggcgggcataccagccagcgagctgggtgcgcgtgtgatccgtgcgctgctggag
cgaagcggtgtgtccggggatcagattggcgaggtcatcctgggacaggtgcttcaggcc
gccgccggtcagaacccggcccgccaggcggccctggctgcgggtctgccggtcagcgtg
ccggccatgaccatcaacaaggtctgcggcagcggtctgaaggcggtgcacctggcctgg
caggcggtgcgttgcggtgatgccgaggtggtgattgccggcggccaggagaacatgagc
atggccccccacgtcctgcccggatcgcgcgtgggcaagaagatgggtggctgggagctg
gtggacaccatgatcaccgacggcctctggtgcgccttcaacaactgccacatgggcaac
accgccgagaatatcgccaaacagttcgagatcggccgcgcggaccaggatgccttcgct
gccgagtcccagcagcgcgcggaacgggcccagaaggccggggtgttccgcgacgagatc
gtgccggtggagatcccccagcgtaagggcgatcccatcgtgttcgacaccgacgagttc
ccccgtcacggcaccacggcacagacccttgccggcctgcgcccggccttcgacaaggaa
ggcagcgtgaccccgggcaatgcctcgggcatcaacgacggtgccgccgtggtgatggtg
atgagcgagtcacgcgccaaggcgctgggactcaagcccctggcgcgcatcgtctccttc
gccgccaccggcgtggacccggcgatcatgggtaccgggccgatccccgccaccaccaaa
tgtctggagcgcgccggctggaagccctcggatctggacctggtggaggccaacgaggcc
ttcgccgcccaggcgattgcggtgaaccgttccctgggctgggatctgtccagggtcaac
atcagcggcggtgccatcgccctgggtcatcccatcggcgcctcgggggcgcgggtgctg
gtcacgctgctgcacggcatgaagcgcaccggcgcccgcaaggggctggcgacgctgtgt
atcggtggcggacagggcgtggccatggcggtggagggactgtga

DBGET integrated database retrieval system