KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1895
Entry
Tgr7_1895         CDS       T00840                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1895
Enzymes [BR:tgr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Tgr7_1895
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1895
SSDB
Motif
Pfam: T2SSE TrwB_AAD_bind FtsK_SpoIIIE Zeta_toxin AAA_28 AAA_16 ABC_tran MMR_HSR1 AAA_25 IstB_IS21 MobB CbiA DEAD ResIII Dynamin_N AAA_29 AAA_7 KTI12 APS_kinase TsaE GTP_EFTU DnaB_C AAA_18 CLP1_P RsgA_GTPase SRPRB AAA_22 YqeC AAA_23
Other DBs
NCBI-ProteinID: ACL72976
UniProt: B8GSW1
Position
2021276..2022346
AA seq 356 aa
MSAVPQLPHEPRSSAAASLERRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLS
SGRAPMGVEMPEADGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPA
FALRKRAIGVIPLERYVVDGMMTAAQAGFLVQAVRERQNIVIAGATSSGKTTLANALLAE
IAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVSMTELVRSSMRLRPDRVVVGEVRGAE
ALDLIKVWGTGHPGGIATIHAGSALGALLRMEQLILEVAVNPPRALIAEAVNVVIHIAGR
GRKRRIESIARVVGFDGVGYRLADALETPFPELPLFPEAAPAAATSPSPDQPGELP
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagtgccgttccgcaactcccgcatgagccgcgttcgtctgctgccgcctcccttgag
cgacgcatccagatgctgcgcacggcaatggggccgctgatcgccaccgcgctcgaagac
cccgacgtggtggaaatcatgctcaaccccgatcgcaccctttgggtggatcggctttcg
agtgggcgcgcgccgatgggcgtggagatgcccgaggccgatggcgagcggatcatccgc
ctggtcgctgcccacgtcggcgcggaagtccatcgcggccagccgctgctgtcggctgaa
ctgccggagacgggcgagcgattcgagggcatcttgccgcccgccgcgccggggccggcc
ttcgcgctgcgcaagcgcgccatcggcgtgatcccgctggagcggtacgtcgtggacgga
atgatgaccgccgcccaggcgggctttctggtgcaggccgtgcgcgagcgccagaacatc
gtgatcgccggggccaccagcagcggcaagaccacgctggccaatgcgctgctggcagag
attgccgccaccggcgaccgcgtgttggtactcgaagacacggtggagctgcaatgcgcg
gcgcgtgaccacgttccgctgcgcacgcgcgcgggggtggtgtccatgaccgagttggtg
cgctcctccatgcgcctgcgacccgatcgcgtggtggtcggcgaggtgcgcggcgccgag
gcgctggatctcatcaaggtgtggggcaccggccaccccggcggcatcgccacgatccat
gcgggttccgcgctgggcgcgttgctgcgcatggagcaactgattctcgaagtggcggtg
aacccgccgcgtgcgctgatcgccgaggcggtcaacgtggtgatccacatcgccggtcgc
gggcgcaagcgccgcatcgagagcatcgcccgcgtcgtcggcttcgacggtgtgggctac
cgattggcggatgcgctggagacaccgtttcccgagctgccgctatttcccgaggccgca
cccgctgcggcgacttccccgtcccctgaccaacctggagaactgccatga

DBGET integrated database retrieval system