KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1896
Entry
Tgr7_1896         CDS       T00840                                 
Name
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1896
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1896
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ACL72977
UniProt: B8GSW2
Position
2022343..2022735
AA seq 130 aa
MTQMIVPAFRFSANPALRLPARSRLHSLARPAAQGLLLAALLLLLAGTAQAAGSSMPWEG
PLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLS
FFSFSGGAVV
NT seq 393 nt   +upstreamnt  +downstreamnt
atgacgcagatgatcgttcctgctttccgtttttctgcaaatccggctttgcgccttccc
gcgcggtcgcggctgcacagcctggcccgccctgcggcgcaaggcttactgctggccgca
ctgctgctgttgctggctggaaccgcgcaggccgccggttcctcgatgccgtgggaaggc
ccgctgcaatccatcctcgaatccatccaggggccggtggcgcgcatcgtcgccgtcatc
atcatcatcgccacgggcctcgcgctggccttcggcgacacgtcaggcggcttccgcaag
ctgatccagatcgtgttcggcttgagcatcgccttcgccgcgtcctcgttcttcctgtcg
ttcttttcgttctctggcggggctgtcgtatga

DBGET integrated database retrieval system