KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1897
Entry
Tgr7_1897         CDS       T00840                                 
Name
(GenBank) putative conjugal transfer TrbD transmembrane protein
  KO
K20529  type IV secretion system protein TrbD
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1897
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1897
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACL72978
UniProt: B8GSW3
Position
2022732..2023004
AA seq 90 aa
MSGPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVG
HSLAVWGARVDPQFMAVFARHIKHRPLLDV
NT seq 273 nt   +upstreamnt  +downstreamnt
atgagcggcccggacaccttcgcggccgggttcgaggtgccgctgcatcgctcgctcacc
gagccgatcttgctgggcggcgcaccgcgcaccgtggcgatcgccaacggcacgctggcc
gccgccgtcgggctgggcctgcaactgtggattccgggcgtggtgctctggatcgtcggc
cattcgctggcggtgtggggtgcgcgcgtcgatcctcagttcatggccgtgttcgcccgg
cacatcaagcatcgcccgctgctggacgtgtga

DBGET integrated database retrieval system