KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1899
Entry
Tgr7_1899         CDS       T00840                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1899
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1899
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1899
SSDB
Motif
Pfam: DUF4141 DUF2749 DUF948 LZ3wCH
Other DBs
NCBI-ProteinID: ACL72980
UniProt: B8GSW5
Position
2025467..2026192
AA seq 241 aa
MKKRLVAAAIAAMLCTATAHAQWVVIDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLM
NQARNLASLPSSVVGQLRANLATTERLIAQARGLAYDVTNLDREFARLYPEQYAATVSGD
QMYRDAQERWKNTLNGLQTTMQMQAQVSQNLGEDESVLADLVGKSQSAQGALQAMQAMNQ
LLALQAKQSIQSQRLQITQDRAASLELARQAAATERAREVRRRFLGEGTPYTPQSVNFYR
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagaagcgccttgtcgccgcggccatcgcggccatgctttgcacggccactgcccat
gcgcaatgggtcgtgatcgaccccaccaacctcgtgcagaacacgctgactgcgatccgc
acgctggagcaaatcaacaaccagatccaacagcttcagaacgaagcgcagatgctgatg
aaccaggcgcgcaacctcgccagcctgccgtccagcgtggtcggccagttgcgcgccaac
ctggcaacgaccgagcggttgatcgcccaggcccgaggcttggcctacgacgtgacgaat
ctggatcgggagtttgcccgcctgtacccggagcagtacgccgccaccgtcagcggcgac
cagatgtaccgcgacgcccaggagcgatggaagaacacgctcaacggcttgcagaccacc
atgcagatgcaggcgcaggtgtcgcagaacctgggcgaagacgaaagcgtgctggccgat
ctggtcggcaagagccagtcggcgcaaggcgcgttgcaggcgatgcaggccatgaaccag
ttgctcgccttgcaggccaagcagtcgatccagtcgcagcggctccagatcacgcaagac
cgggccgcctcgttggaactggcgcggcaggcggcggccaccgagcgcgcccgcgaagtg
cggcggcgcttcctcggggaaggcacgccgtacacgccgcagtccgtcaacttctaccgc
gactga

DBGET integrated database retrieval system