KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1901
Entry
Tgr7_1901         CDS       T00840                                 
Name
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1901
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1901
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ACL72982
UniProt: B8GSW7
Position
2026521..2027903
AA seq 460 aa
MNDVTIIDQFLNTFAAYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDV
IAKLLRKVLYVGAFAYIIGNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGL
DAGGPIFLQLDDMMGFPEVFLNLDAILVLFLAWLVVVLCFFVLAIQLFITLIEFKLTTLA
GFVLVPFALWNKTSFLAEKVLGNVVASGVKVLVLAVIVGIGSGLFTQFQVHPDEPSLDHA
LVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAAIGAAGTAVAVGAAATGVGSA
VAAGARMAPAAAKLAGSGARAATSAAGSAKSAFQAGSAAAGGGAKGAMAGLGNVAKTGAQ
AAGRGAASRASAVGQRMAAPFRAGWNGAAADSGAGAASGQGVGEATPSASNAQTQEQPAW
AKRLHRRQQLTHAATTTAHALRGGDGGGSGQGPSLRDSDS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaatgacgtgaccatcatcgaccaattcctcaacacattcgccgcctacatcgactcg
ggtttcgggctgctgcggggcgaagtagcgttcctcacggccacgctgatcgtcatcgac
atgacgatcgccggcctgtattgggccatgagccatgccaccggccagggcgaggacgtg
atcgccaagctgctgcgcaaggtgctctacgtcggtgccttcgcctacatcatcggcaac
ttcaactggctggccagcatcgtgttccgctcgtttgcgggattgggtatcaccgccacc
ggctcggcaatcacgatggagaacttcttgcagccgggccgactggcgaaaaccggcctt
gacgcgggcgggcctatcttccttcagcttgacgacatgatgggatttcccgaggtgttc
ttgaacctcgatgccatcttggtgctgttcctcgcctggctggtcgtggtgctctgcttc
ttcgtgctggcgatccagcttttcatcacgctgatcgaattcaagctgaccacgctcgca
ggctttgtgctggtgccgttcgcgctgtggaacaagacgagctttctggcggaaaaagtg
ctgggcaacgtcgtggcctccggcgtcaaggtgctggtgttggccgtgattgtcggtatc
ggctcgggtctgttcacccagttccaagtccatcccgatgagccgtccctcgaccatgcg
ctggtcatcatgctggcctcgctcactttgctggcgctggggatcttcggccccggcatc
gccacgggccttgtgtccggtgcgccgcagctcggcgcgggcgcgatggcgggcgcggcc
atcggcgcagccggaacggcggtggccgtcggtgccgccgcgacgggcgtgggcagtgcg
gtagctgctggcgcgcgcatggccccggccgccgccaagctggccggcagcggcgcgcgt
gccgccacgtcggcggcgggcagcgcgaagtcggcgttccaggccggttccgccgcagca
ggcggcggtgccaaaggcgcgatggcgggcttgggcaacgtcgccaagaccggcgcgcag
gcagccggacgaggcgctgcatcccgtgcctccgctgtcgggcagcgcatggccgctccg
ttccgtgctggctggaatggcgctgcggccgacagtggcgcaggggcggcatccggtcag
ggagttggcgaggccacgcccagcgccagcaacgcgcagacgcaggaacaacctgcctgg
gcgaaacgactgcatcgccgccaacagctcacccatgccgcgaccaccaccgcccatgcg
ctgcgcggtggcgacggcggcggctccggccaagggccgagcctgcgcgattccgattca
taa

DBGET integrated database retrieval system