KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1902Help
Entry
Tgr7_1902         CDS       T00840                                 

Definition
(GenBank) Conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tgr7_1902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1902
Secretion system [BR:tgr02044]
 Type IV secretion system
  Trb secretion system protein
   Tgr7_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ACL72983
UniProt: B8GSW8
Position
2027916..2028620
Genome map
AA seq 234 aa AA seqDB search
MRFKKPQVRYADTPQPATPYQAAGQVWDDRIGSPRVQAKNWRLMAFGCLTLALLMAGGLV
WRSAQSFVTPYVVEVDNAGQVRAVGEAATPYKPSDAQTAYHLGRFIGLVRSLSIDPIVVR
QNWLDAYDYTTDKGAAVLNDYARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRY
VNGAAAGLDRWTAVVSIVLQPPRTEERLRKNPLGIYVNGLSWSRELDSSEGAKP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaagaaaccgcaggtgcgttacgccgacacgccgcagcctgccacgccgtac
caagctgccggccaggtatgggacgaccgtatcggctcgccgcgcgtgcaggcgaagaac
tggcgcctgatggccttcggctgcctcaccctcgcgttgctgatggccggcggcctggtg
tggcgctccgcgcagtcctttgtgacgccctacgtcgtggaggtggacaacgcgggccag
gtgcgcgcagtgggcgaagccgccacgccatacaagcccagcgacgcacagaccgcgtac
cacctaggccgcttcatcggcctggttcgctcgctgtccatcgaccccatcgtcgtgcgc
cagaactggctcgacgcctacgactacacgaccgacaagggcgcggccgtgctcaacgac
tacgcgcgggtcaacgacccgttcgcgcgcatcggcaaggagtcggtgacggtgcagatc
accagcgtcgtgcgcgccagcgacacgtctttcaacgtgcgctggacagaacgccgctac
gtcaacggcgccgcggcgggactggatcggtggacggccgtggtgtccatcgtgctccag
ccgccgcgcaccgaagaacgcctgcgcaagaaccccctgggcatctacgtcaacggcctg
tcgtggagccgcgaactggattcttccgaaggagccaagccatga

DBGET integrated database retrieval system