KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2116Help
Entry
Tgr7_2116         CDS       T00840                                 

Definition
(GenBank) Arylesterase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tgr7_2116
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tgr7_2116
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Tgr7_2116
Lipid biosynthesis proteins [BR:tgr01004]
 Fatty acid synthase
  Component type
   Tgr7_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: ACL73196
UniProt: B8GTV2
Position
2244430..2245068
Genome map
AA seq 212 aa AA seqDB search
MFVVVFHVFLAAPVLADAQERHTLVVLGDSLSAAYGMAEREGWVALLERRLSDEDLPWRL
VNASISGDTTRGGLTRLPRVLERHEPALVIIELGGNDGLRGVHPNIMIDEMRENLAELVR
LSRESGAEVLLLGMHLPPNYGNHFTERFHAVYHEVAREHGVPLVPFFLEGVAEDRALMQP
DGIHPTAEAQARMLENVWETLKPMLERRVAGS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtcgtcgtattccacgtcttcctggccgcacccgtcctggcggacgcccaggag
cgccacaccctggtggtgctgggtgacagcctgagcgccgcctacggcatggccgagcgg
gagggctgggtggccctgctggagcggcgcctgtccgatgaggacctgccctggcggctg
gtcaacgccagcatcagcggcgacaccacccggggcggactcacccgtctcccccgggtc
ctggaacgccacgaaccggcgctggtgatcatcgaactgggaggcaacgacggcctgcgg
ggcgtgcatccgaacatcatgatcgacgagatgcgcgagaacctcgccgaactggttcgc
ctgagccgggagtccggggccgaggtgctgctgctcggcatgcacctgccacccaactac
ggcaatcatttcaccgagaggttccacgccgtgtaccacgaggtggcccgggagcacggc
gtgcccctggtgcccttcttcctggaaggggtggccgaggatcgcgcgctcatgcagccc
gacggtatccaccccaccgccgaagcgcaagctcgcatgctggaaaacgtgtgggagaca
ctcaagccgatgctggagcgccgggttgccggctcgtag

DBGET integrated database retrieval system