KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2343Help
Entry
Tgr7_2343         CDS       T00840                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00521  Streptomycin biosynthesis
tgr00523  Polyketide sugar unit biosynthesis
tgr01130  Biosynthesis of antibiotics
Module
tgr_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tgr7_2343
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tgr7_2343
Enzymes [BR:tgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Tgr7_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACL73422
UniProt: B8GV76
Position
2467252..2467821
Genome map
AA seq 189 aa AA seqDB search
MNVIETTLPGVLLIEPRVFGDERGFFMETYQASRYAEAGIAGPFVQDNLSLSRHGILRGL
HLQHPGAQGKLVSVLKGEVFDVAVDVRTDSPTFGQWVGEYLSETNKRQLWVPEGFAHGFC
VTSDEALFAYKCTRLYSPQTEISIRWDDPAIGIQWPVDAPALSQKDQAGLFLADIAPDQL
PAYMSETTS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcatagagacaacactaccgggcgtcctgttgatcgagccccgggtattcggg
gacgaacgcggttttttcatggaaacctatcaggcatcccgttacgccgaagccggtata
gcgggtccctttgtccaggacaatctgtcactgtccagacacggcattctcagaggcctt
cacctgcaacatccgggtgctcaggggaaactcgtttcagtcctgaagggcgaagtgttc
gacgtggccgtcgacgtacgtacagattcacccacgttcgggcaatgggtgggggaatac
ctctccgaaacaaacaaacgccagctctgggtgcccgagggtttcgcccacggattctgc
gtcaccagtgatgaggccctgttcgcctacaaatgcacccgcctctattcgccacagacc
gagatcagcatccgctgggacgatccggccatcggcattcaatggcctgttgatgcaccg
gctctgtcccagaaggaccaggcaggcctgtttctggccgacatagccccggaccagctt
cctgcctatatgtcagagaccacatcatga

DBGET integrated database retrieval system