KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2603Help
Entry
Tgr7_2603         CDS       T00840                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00020  Citrate cycle (TCA cycle)
tgr00620  Pyruvate metabolism
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Module
tgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tgr7_2603
   00620 Pyruvate metabolism
    Tgr7_2603
Enzymes [BR:tgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Tgr7_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_3 HI0933_like Amino_oxidase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ACL73678
UniProt: B8GM91
Position
complement(2744081..2745472)
Genome map
AA seq 463 aa AA seqDB search
MAQVFDLLIVGGGVTGSALLYVASRYTDIKHIGMLEKYAAPARVNSLHSNNSQTLHCGDI
ETNYSLEKALKVQRAARMVENYAVAQPDIDHLIFRYPKMVLGVGERECQQLRKRFETLSP
HYPKLRLLEAKDIARMEPAVAYSKGSPRADEIVALGSENEYTAVNFEALARSFVRQAQRV
GDKQVSVEYNQRVLHIRRKGEVFVVETGDTSFQARSIVVCAGGHSLKLAHDLGYGHHFSV
LPVAGSYYFTPQVLRGKVYTVQNDKLPFAAIHGDPDVMVPGKTRWGPTALVLPVLERYNW
ETVKDFMRVFNFDRKVWDVLYDLLKVPDIRNYMLKNFLFEVPVLRRDLFLRDVRKIVPDI
KFRDLKFARHVGGIRPQLIDKENRRLMMGEAKIDTGLGAIFNMTPSPGATCCLENAEVDM
RAVAQFLGAKVDEERFARDLLRGDSRHAASDLPTHLISGEDAS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggttttcgatctgttgatcgtcggcggcggtgtcaccggctcggcgctgctg
tacgtcgcgagccgctacaccgatatcaagcacatcggcatgctggagaagtatgccgcg
ccggcgcgggtcaattccctgcacagcaacaacagccagaccctgcactgcggcgacatc
gagaccaactacagcctggagaaggccctcaaggtgcagcgcgcggcgcgcatggtggag
aactacgccgtcgcccagccggatatcgaccacctgatcttccgctatcccaagatggtg
ctgggggtcggcgaacgggagtgccagcagctgcgcaagcgattcgagaccctttcaccc
cactacccgaagctgcgcctgctggaggcgaaggacatcgcccgcatggaaccggcagtg
gcctacagcaagggcagcccgcgcgccgacgagatcgtcgcgctgggttccgagaacgaa
tacaccgcggtcaacttcgaggccctggcccgctccttcgtgcgccaggcccagcgggtc
ggggacaagcaggtgtcggtggagtacaaccagcgggtgctgcacatccgccgcaagggc
gaggtgttcgtggtggagaccggcgacaccagcttccaggcgcgcagcatcgtggtctgc
gccggcgggcacagcctcaagctcgcccacgacctcggctacggccaccacttctcggtg
ctgccggtggcgggcagttactacttcaccccccaggtgctgcgcggcaaggtctacacg
gtgcagaacgacaagctgccgttcgccgccatccacggcgatccggacgtgatggtgccg
ggcaagacccgctgggggcccaccgccctggtgctgccggtgctggagcgctacaactgg
gagacggtgaaggacttcatgcgggtgttcaacttcgatcgcaaggtctgggacgtgctc
tacgacctgctcaaggtgccggacatccgcaactacatgctcaagaacttcctgttcgag
gtgccggtgctgcgccgcgacctgttcctgcgcgacgtgcgcaagatcgtcccggacatc
aagttccgggatctgaagttcgcccgccacgtgggcggcatccgcccgcagctgatcgac
aaggagaaccggcgcctgatgatgggcgaggcgaagatcgacaccgggctcggcgcgatc
ttcaacatgacgccctcaccgggcgccacctgctgcctggagaacgccgaggtggacatg
cgcgccgtggcgcagttcctgggcgcgaaggtggacgaggaacgcttcgcccgtgatctg
ctgcggggcgacagccggcatgcggcgtccgacctgccgacgcacctgatcagcggcgag
gacgccagctga

DBGET integrated database retrieval system