KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2842
Entry
Tgr7_2842         CDS       T00840                                 
Name
(GenBank) putative secreted protein
Organism
tgr  Thioalkalivibrio sulfidiphilus
SSDB
Motif
Pfam: Glutaredoxin AhpC-TSA
Other DBs
NCBI-ProteinID: ACL73915
UniProt: B8GNM4
Position
2982258..2982989
AA seq 243 aa
MKPWFVRFVLAFAVASMASAIAVAQNAPAADSRIVQSRDRTAIDADLDERLARDWGLQNE
EWARYRQLMQGPLGVYSPGLDPFTALGIEARTNEERRRYAELQVQAEARRVEKLLAYQRA
YDDAWKRLHPTLQPVVLTDAGATPATSGALGRLAVFVKDDCPPCEQRVRQLQTAGTAFDL
YMVGSRQDDARIRQWAAKAGIEPAKVRARTITLNHDAGRWLSIGVPGELPAVVREVNGQW
LRQ
NT seq 732 nt   +upstreamnt  +downstreamnt
gtgaagccgtggttcgttcgtttcgttctcgccttcgccgtggcgtcgatggcttcggcg
atcgccgtcgcgcagaacgcgcccgccgccgactctcgcatcgtccagagccgcgaccgg
accgccatcgacgccgatctcgacgaacgcctggcacgggattgggggctgcaaaacgag
gagtgggcacgctaccgccagttgatgcaggggccgctgggcgtgtactcgcccggcctc
gatcccttcacggccctgggcatcgaagcgcgcacgaacgaggaacgccgccgctacgcg
gagcttcaggtgcaggccgaggcccgccgcgtcgagaagctgctggcgtaccagcgcgcc
tatgacgatgcctggaagcggctccatcccacgcttcagcccgtcgtcctgaccgatgcc
ggtgccactcccgccacgtccggcgccctgggccggctggcggtcttcgtcaaggacgac
tgcccgccctgcgaacagcgcgtgcggcaattgcagacagcaggcacggcctttgatctc
tacatggtcggcagccgccaggacgatgcgcgcatccggcaatgggcggccaaggcgggc
atcgagccggccaaggtgcgcgcacggaccatcaccctgaatcacgacgccggccggtgg
ctatcgatcggtgtgccgggcgagctgccggccgtcgtgcgcgaggtcaacgggcaatgg
ctgcgtcagtga

DBGET integrated database retrieval system