KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2844
Entry
Tgr7_2844         CDS       T00840                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tgr  Thioalkalivibrio sulfidiphilus
SSDB
Motif
Pfam: DUF2859 Oxidored_nitro
Other DBs
NCBI-ProteinID: ACL73917
UniProt: B8GNM6
Position
2983555..2984091
AA seq 178 aa
MNIRLCVLPLLGLLALTAHAADQTLVVVEDRGGASALPYYQALNLQPRNPRQALPPPHIE
VPPLPGERHGEADMLPVRSTLLTPGTVERRVIEAQGLRPLFLVGDDERSRAWLRQRVEVL
HELGAVGLVVNVESQVALDALRRLTPELILSPISADDLARRLGIRHYPVLITATGIEQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaacatccgcctgtgcgtactgccgctgctgggtctgctggccctcaccgcccatgcc
gccgaccagacccttgttgtcgtcgaggatcggggcggcgcgtccgccttgccctactac
caggcgctgaacctccagccccgaaaccctcgccaggcactaccgccaccgcatatcgag
gtgccgccgctgccgggggaacgtcacggcgaggccgacatgctgccagtgcgctcgacg
ctgttgacgccgggcacggtggagcgtcgggtgatcgaggcgcaggggttgcgcccgctg
ttcctcgtcggtgatgacgaacgctcacgcgcctggctgcgtcagcgcgtggaagtcttg
cacgaactcggcgcggtcggcctcgtggtcaacgtcgagtcccaggtcgcgctggatgcc
ctgcgacgcctgacgccggaactgatcctgtccccgatctccgccgacgacctggcccga
cggcttggcatccgccactaccccgtgctcatcaccgccacggggatcgagcagtga

DBGET integrated database retrieval system