KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2855
Entry
Tgr7_2855         CDS       T00840                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tgr  Thioalkalivibrio sulfidiphilus
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACL73928
UniProt: B8GNN7
Position
2995050..2995718
AA seq 222 aa
MSRFKNEITHLQAHIKTLRIGAGALFVVALVLGFGWWSAPRDLTIHVPPDLRSGSVRKWW
EVPPESVYAFTFYVFQQLNRWPTNGEDDYARNIHALSAYLTPGCQIFLRRDYEQRRSTGE
LRQRVRGIYEIPGRGFGDDPTARVRVVSDRDWIVTLDITADEYHGAEQVKRALVRYPLKV
VRLDIDPERNPFGLALDCYSSTPQRIAPQGAAASATDGPGGP
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagccgcttcaagaacgaaatcacgcacctgcaggcgcacatcaagaccttgcgcata
ggagccggtgcgctattcgtcgtcgccctggtgctgggcttcggctggtggagtgcgcct
cgcgatctgaccatccacgtgccgccggacctgcgttcgggcagcgtgcgcaagtggtgg
gaggtgccgccggagtcggtctacgcctttaccttctatgtcttccagcagctcaaccgc
tggccgacgaacggcgaggacgactacgcgcgcaacatccatgcgctgtcggcctacctg
acacccggctgtcagatcttcctgcggcgcgactacgagcagcgccgcagcacgggcgaa
ctgcgtcagcgcgtgcggggcatctacgagattccgggtcgcggcttcggcgacgacccg
acggcgcgcgtccgcgtggtgtccgaccgcgactggatcgtcacgctggacataacggcc
gacgagtaccacggcgccgagcaggtcaagcgcgccctggtgaggtatccgctgaaagtg
gtgcgtctggacatcgacccggagcgcaatcccttcggcctggcactggactgttacagc
agtaccccgcaacgcatcgcgccgcagggggcagccgcctccgctaccgatggtcccggt
ggtccgtag

DBGET integrated database retrieval system