KEGG   Taeniopygia guttata (zebra finch): 100190013Help
Entry
100190013         CDS       T01082                                 

Gene name
PPP1CA
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu03015  mRNA surveillance pathway
tgu04114  Oocyte meiosis
tgu04218  Cellular senescence
tgu04261  Adrenergic signaling in cardiomyocytes
tgu04270  Vascular smooth muscle contraction
tgu04510  Focal adhesion
tgu04810  Regulation of actin cytoskeleton
tgu04910  Insulin signaling pathway
tgu05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100190013 (PPP1CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100190013 (PPP1CA)
   04218 Cellular senescence
    100190013 (PPP1CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100190013 (PPP1CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100190013 (PPP1CA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100190013 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100190013 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100190013 (PPP1CA)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100190013 (PPP1CA)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100190013 (PPP1CA)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100190013 (PPP1CA)
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100190013 (PPP1CA)
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100190013 (PPP1CA)
Spliceosome [BR:tgu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100190013 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100190013
NCBI-ProteinID: NP_001232237
UniProt: B5FXE9
Position
Un
AA seq 342 aa AA seqDB search
MADTEKLNLDSIISRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPAGRPVTPPRNSAKAKASGRFSFDSFFYL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaccgagaagctcaacctcgactccatcatcagccgcctcctggaggtccaa
gggtcgcggccggggaagaacgtgcagctgacagagaacgagatccgcgggctgtgcctc
aaatcccgggagatcttcctgagccagcccatcctgctggagctggaggcacccctcaag
atctgcggtgacatccacgggcagtactacgacctcctgaggctctttgagtacgggggc
ttcccccctgagagcaattacctgtttttgggcgactacgtggaccggggcaagcagtcc
ctggagaccatctgcctgctgcttgcctacaaaatcaagtaccccgagaacttcttcctg
ctgcggggcaaccacgagtgtgccagcatcaaccgcatctatggcttctatgatgagtgc
aaacgaagatacaacatcaagctctggaagaccttcaccgactgcttcaattgtttgccc
attgctgccatcgtggatgagaagatcttctgctgccacggagggctgtccccagacctg
cagtcgatggagcagatccggcggatcatgcggcccacggatgtcccggatcaggggctg
ctctgtgacctgctctggtccgaccccgacaaggacgtgcagggctggggggagaacgac
cgtggggtctccttcaccttcggggccgaggtggtggccaaattcctgcacaagcacgac
ctggatctcatctgccgggcgcaccaggtggtggaggatggctacgagtttttcgccaag
cgccagctcgtcaccctcttctcggcccccaactactgcggcgagtttgacaacgccggc
gccatgatgagcgtggatgagaccctcatgtgctctttccagattttgaagccggccgac
aagaacaaaggcaaatatgggcagttcagcgggctgaaccccgccgggcgccccgtcacc
cctccccgaaactctgccaaagccaaagcatcaggtcgcttttctttcgactcgtttttt
tatttgtag

DBGET integrated database retrieval system