KEGG   Taeniopygia guttata (zebra finch): 100190196
Entry
100190196         CDS       T01082                                 
Symbol
HAGH
Name
(RefSeq) hydroxyacylglutathione hydrolase, mitochondrial
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00620  Pyruvate metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100190196 (HAGH)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     100190196 (HAGH)
SSDB
Motif
Pfam: Lactamase_B HAGH_C Lactamase_B_2
Other DBs
NCBI-GeneID: 100190196
NCBI-ProteinID: NP_001232728
Ensembl: ENSTGUG00000006768
UniProt: B5FYT6
Position
14:complement(6902384..6912994)
AA seq 216 aa
MKVEILPALTDNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHA
GGNEKLVKMEPGLRVLGGDSRVGALTQRVSHLTALQVGSLSVKCLSTPCHTSGHICYYVT
KPNSSEPPAVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPKTRVYCGHEYTINNL
KFARHVEPGNPNIQEKLAWARARYDSGEPTIPLHPR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaggtggaaatcctgccagccctcactgacaactacatgtacctcctcatcgaccag
gacaccagggaggctgccatcgttgaccccgtgcagccccagaaggtcttggatgcagtc
aaaaagcacggcgtgaagctgaccactgtcctgaccacccaccaccactgggaccacgct
ggaggcaacgagaagctggtgaagatggagccggggctgcgcgtgctcgggggggacagc
agggtgggggccctgacgcagagagtgtcccacctgacagctctccaggtgggatctctg
agtgtgaaatgcctcagtacgccgtgtcacacctcgggacacatctgttattatgtgact
aagccaaatagctccgagccacctgcagtttttacaggtgacaccctgttcgtggctggc
tgcgggaagttcttcgagggcaccccggaggagatgtacaaggcactgattgagattttg
ggcagcctggaccccaaaacgagggtttactgtggccacgagtacaccatcaacaacctc
aagtttgctcggcacgtggagcccgggaaccccaacatccaggagaagctggcctgggcc
agggcccgttacgacagtggagagcccaccatacccctccaccctcgctga

DBGET integrated database retrieval system