KEGG   Taeniopygia guttata (zebra finch): 100190233Help
Entry
100190233         CDS       T01082                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00062  Fatty acid elongation
tgu01100  Metabolic pathways
tgu01212  Fatty acid metabolism
tgu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100190233 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100190233 (PPT1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100190233 (PPT1)
Lipid biosynthesis proteins [BR:tgu01004]
 Fatty acid synthase
  Component type
   100190233 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest U71
Motif
Other DBs
NCBI-GeneID: 100190233
NCBI-ProteinID: NP_001232131
Ensembl: ENSTGUG00000001213
UniProt: B5FZ59
Position
23
AA seq 292 aa AA seqDB search
MAALMAAVPLLALLSLLALCPGPAAAAAPLVIWHGMGDSCCNPVSMGYIQKLVEKKIPGI
YVLSLKIGSSLIQDMENSFFMNVNEQVREVCGQLAADPRLQGGYNAMGFSQGGQFLRAVV
QRCPAPPMLSLISIGGQHQGVYGFPRCPGESSHLCDWIRKTLDLGAYTKAVQEHLVQAEY
WHDPLKEEDYRKNSIFLADINQERGINETYKKNLMALKKFVMVKFLNDTMVDPPISEWFG
XLQKWPSQGDHPAAGDLTVQRGSPGAAGDGQSREVGVPGGEGGSPALLRRVV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcatggcggcggtgccgctgctggcgctgctgtcgctgttggcgctgtgt
ccgggccccgcggccgccgccgcgcccctggtgatctggcacggcatgggtgacagctgc
tgcaatccggtgagcatgggctacatccaaaaattggtggagaaaaaaatccctgggatt
tacgtcctgtcgctgaagatcgggagcagcctgatccaggacatggagaacagcttcttc
atgaacgtcaacgagcaggtgagggaggtgtgtgggcagctggccgccgacccccggctg
cagggcggctacaacgccatgggcttctcccagggaggccaattcctgagggctgtggtc
cagaggtgccctgctcctcccatgctcagcctgatctccatcgggggacagcaccaaggg
gtgtacggcttcccacgctgccccggggagagctcccacctctgcgactggatccgaaaa
accctggatctgggagcctacaccaaggctgtgcaggagcacttggtccaagcagagtat
tggcacgacccgctgaaggaggaggactacaggaaaaacagcattttcctggctgacatc
aatcaggagaggggcatcaacgagacctacaagaaaaacctgatggctctgaaaaagttt
gtgatggtgaaattcctcaacgataccatggtggaccctccaatctctgagtggtttggg
nttttacaaaagtggccaagccaaggagaccatcccgctgcaggagacctcactgtacaa
agaggatcgcctggggctgcaggagatggacaaagcagggaagttggtgttcctgggggt
gaagggggatcacctgcacttctcagaagagtggtttga

DBGET integrated database retrieval system