KEGG   Taeniopygia guttata (zebra finch): 100190490Help
Entry
100190490         CDS       T01082                                 

Gene name
CWC15
Definition
(RefSeq) CWC15 spliceosome associated protein homolog
  KO
K12863  protein CWC15
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100190490 (CWC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tgu03041]
    100190490 (CWC15)
Spliceosome [BR:tgu03041]
 Complex B
  Other components
   Prp19 complex
    100190490 (CWC15)
 Complex C
   Prp19-CDC5 complex
    100190490 (CWC15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cwf_Cwc_15 UPF0524
Motif
Other DBs
NCBI-GeneID: 100190490
NCBI-ProteinID: NP_001232136
Ensembl: ENSTGUG00000012817
UniProt: B5G3N4
Position
1
AA seq 230 aa AA seqDB search
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR
RELEERERVAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEDDEDDDLE
DSDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPAQPQ
ANFKVKRRWDDDVVFKNCAKGIDETKKDKRFVNDTLRSEFHKKFMEKYIK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcggcaaggccaacgtttgaacctgcaagaggaggaagaggaaaaggtgaa
ggagacttaagccagctatccaaacaatattctagcagagatcttccttctcatacgaaa
atcaaatacagacagaccactcaggatgctcctgaagaggtgcgtaaccgtgatttcaga
agggagctggaggagagagagcgagttgctgccagagaaaagaacagagacagaccaacc
agagaacatacaacatcatcttctgtgtctaagaagcctcggctagaccagattcctgcg
gcaaatcttgatgcagatgatcctcttactgatgaagatgatgaagatgacgacttggaa
gacagtgatgatgatgacactgcagctcttctggctgaactggaaaaaatcaagaaagaa
cgagctgaagagcaagctcgaaaggaacaagagcaaaaggctgaagaagaaagaattcgg
atggagaacatcctgagtggtaacccgctgctgaacctcactgggccagcacagcctcag
gcaaacttcaaagttaaaaggaggtgggatgacgatgttgtcttcaagaactgtgccaag
gggatagacgaaacaaaaaaggacaaaagattcgtcaatgatactctgcgatcagagttt
cacaaaaagttcatggaaaaatatatcaagtag

DBGET integrated database retrieval system