KEGG   Taeniopygia guttata (zebra finch): 100190660Help
Entry
100190660         CDS       T01082                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00480  Glutathione metabolism
tgu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100190660 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100190660 (GPX1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100190660 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 100190660
NCBI-ProteinID: NP_001130041
UniProt: B5FYK1
Position
12
AA seq 197 aa AA seqDB search
MAAAGAGAGAARLAELSAKPLGAAKPLSLGSLRGKVLLVVNVASLUGTTTRDFLQLNELQ
QRYGPRGLQVLGFPCNQFGHQENGTNDEILPMLEHVRPGNGYKPNFTMFEKCEVNGKDAH
PLFTFLKEALPFPHDDPSSLMTNPQYIIWSPVCRNDIAWNFEKFLIGPDGVPFKRYSRRF
ETIKIQDDIELLLQKVA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgggagcaggtgcgggcgcggcgaggctggcggagctgtcggcgaagccc
ctgggcgcggcgaagccgctctcgctgggctcgctgcggggcaaggtgctgctggtggtc
aatgtggcgtcgctctgaggcacgacaacgcgcgacttcctgcagctcaacgagctgcag
cagcgctacggcccccgcgggctccaggtcctcggcttcccctgcaaccagttcggtcac
caggaaaacggcaccaacgatgagatccttcccatgcttgagcacgttcgtcctggcaac
gggtacaagcctaatttcaccatgttcgagaagtgcgaggtgaacgggaaggatgcgcac
cccctgttcaccttcctgaaagaggcgctgcccttcccgcacgacgacccctcctcgctg
atgaccaacccgcagtacatcatctggtccccggtgtgccgcaacgacatcgcctggaac
ttcgagaagttcctcattggccccgacggtgtgcccttcaaacgctacagccggcgtttc
gaaaccatcaagatccaggacgacattgagttgcttctgcagaaggttgcctag

DBGET integrated database retrieval system