KEGG   Taeniopygia guttata (zebra finch): 100217889Help
Entry
100217889         CDS       T01082                                 

Gene name
NRK
Definition
(RefSeq) nik-related protein kinase isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100217889 (NRK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgu01001]
    100217889 (NRK)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100217889 (NRK)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100217889 (NRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100217889
NCBI-ProteinID: XP_030128421
Ensembl: ENSTGUG00000003240
Position
4A
AA seq 1229 aa AA seqDB search
MARGLDGIDLAALRDPAGIFELVQVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTENEEEE
IKLEINMLKKYSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTDLVKKTKGNCF
KEDWIAYICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTIGRR
NTFIGTPYWMAPEVIACEENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMRALFLI
PRNPPPKLKSRKWSKKFLNFVESCLVKHYLHRPSTETLLKHSFIRDMQNERQVRIMLKDH
LDRTRKKKGEKEETDYDYSGSEEEDDELNEDEGEPSSIVNLPGESTLRREFLRLQQENKN
RSDPHRQQQQLKDQEKYKKQLLAERQKRIEQQKEQRRRLEDHQRREQELRRQQECEQRWP
EVQVSQRKEERGKEDKRAVEDEYFIVDGQRKIEKKQKMEDVQHNRKMHRTLPKDQTQLLS
LQHDHKQKKELSKSPNAGVHPPSSSTSKEAEDRAKKSDSIQPSLWPVALGHEATPPARMG
SGSSSSPCTPAPQRALLLQCENFRASKDVYHSSSLSDMVTAPLSPGQDDVFWSMSDSKEQ
PPKVPERTTSKFYSRDQPGHQRCLSSASHQSSPGGHALKLNSSSSIPGTKQWEVGSHQSS
WSTSGNPGLTKAENVLSQNHVQLHQKPEKVSHPGQTASPGSFAKVKDSANSLLKAIEYSS
SSDEGSSSSSSDEDDTNHTRQLLSSRIADFSRTRIPDGIELKPQSTVAGQKDQILGKQIP
NTQEGLWSVNNQNYLLPDLLQQSQITDSSVNPPQVPLTCQEPQNKPLTKSPCAESPPAKS
STSSTTSFTSFIDPRLLPITPPTSPVGPSCSSPSSAKPEPVRRENARKGSVVNVNPTNIR
PQSDSPEIRKYKKKFNSEVLCAALWGVNLLVGTENGLWLLDRSGQGRVYTLITRRRFQQM
DVLEGLNVLITISGKKNKLRVYYLSWLRNKILRNDPEVEKRQGWVSVGDLEGCVHYKVVK
YERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFTSLHHKPLSVDLTVENGQRLKVIYGS
VVGFHAIDVDSGSVYDLYLPTHIQGTIRPHAIIILPNTSGMELLLTYEDEGIYIDIYGHF
TKETVLQWGEMPASVAYLQSNQVMGWGEKAIELRSVETGNLEGVFMHKKAQKLKFLCERN
DKVFFASVQSGGSSQIYFMTLGQNVLFNW
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcggcctggacggcatcgacctggcggcgctgcgggaccctgcgggaatattt
gaactggtgcaagttgttggaaatgggacatatggacaagtctacaagggtcgccatgtt
aagactgggcagctggcagcaatcaaagtgatgaatgttactgagaatgaagaggaggaa
atcaagctggagataaacatgctaaagaagtactcccatcaccggaatattgctacatat
tacggggcttttgtaaagaaaagtcctgcaggccaagacgatcagctctggctggtgatg
gagtactgcggtgcaggctctgtcaccgacttggtaaagaagacaaaagggaactgtttc
aaggaagactggattgcttacatctgcagagaggttctcaggggcttggcacatcttcat
gctcaccatgtcatccatagagatattaaaggacagaatgttcttctcacagaaaatgca
gaggtaaaattggtggattttggtgtaagtgctcagctggacaggacaattgggagaaga
aacacatttattggcaccccgtattggatggcacctgaggtcattgcttgtgaggagaac
ccagactctacatatgattacagaagtgacctgtggtctctgggaatcactgctattgaa
atggctgaaggagctcctcccctgtgtgacatgcatcccatgagagcactcttccttatc
ccaaggaacccgcccccaaagctgaaatccagaaaatggtcaaagaagttcctaaacttt
gttgagagctgccttgtaaagcattatttgcatcgcccatctacggagaccctgctgaag
cattccttcatccgcgacatgcagaacgagcggcaagtgcgcatcatgctgaaggaccac
ctggacaggacgaggaagaagaaaggagaaaaggaagaaacggactatgattacagtgga
agtgaggaggaagacgatgagctgaatgaagatgaaggcgaaccaagctccatagttaat
ctcccgggggagtcaacgctccgccgtgaatttctgaggctgcagcaggagaacaaaaac
cgttcggaccctcaccggcagcagcagcagctgaaggaccaggagaagtacaagaagcag
ctgctggcagagcggcagaagcgcatcgagcagcagaaggagcagaggaggaggctggag
gatcaccagaggcgagagcaggagctacgaaggcagcaggagtgtgagcagaggtggcca
gaggtgcaagtcagtcagaggaaagaggaaaggggtaaagaagacaaaagggctgtggaa
gatgaatacttcatagtagatggacaaaggaaaatagaaaagaagcagaagatggaggat
gtgcagcacaacaggaagatgcacagaactctccccaaagatcagacacagctgctgtct
ctccagcatgaccacaagcagaagaaggaactttccaagagtccaaatgcaggagtgcat
cctccatcaagcagcacaagcaaagaggccgaggaccgagcaaagaagagtgacagcatc
cagcccagcctgtggccggtggcgctgggacacgaggccaccccgccggccaggatggga
tccgggagcagctccagcccctgcacccccgcgccacagagagccctgctcctgcagtgt
gagaatttccgggctagtaaggacgtgtaccacagcagctccctgtcagacatggtgaca
gcaccgctcagccctgggcaggacgatgtgttctggagcatgagcgacagcaaagagcag
cccccaaaggttccagaaaggacaacctcgaaattttacagcagggatcagcctggccat
cagagatgcctttcaagtgccagtcatcagtcatcccccgggggacatgctctgaagctg
aacagtagcagcagcattcctggcaccaagcagtgggaggtgggatctcatcagagcagc
tggtcaacctcagggaatccaggactgaccaaggcagagaatgttttgtcccagaaccac
gtgcagttgcatcagaagccggaaaaagtttctcatccaggccagactgcaagtccaggc
tcctttgccaaggtgaaggacagtgccaactccttgttaaaagcaatagagtattcctcc
tcaagtgatgaaggcagcagcagcagcagcagtgatgaagatgacacaaaccacacaagg
caactgctaagcagcagaattgcagatttctcaaggacaaggataccagatggaattgaa
ctgaaaccccaaagcaccgtggcaggacagaaggatcagattttagggaaacaaattcca
aacactcaagaaggcctttggagtgtaaacaaccagaactatctcctgccagatctcctc
cagcaaagccaaattacagactcctctgtgaacccaccacaagtgccactgacttgccag
gaacctcagaacaaacctctgactaagagcccatgtgctgaaagcccacctgccaagagc
agcacatcctccacaacatccttcacatcattcattgatccaagacttctgccaatcacc
cctcccaccagtccagtaggaccttcctgtagttctccatctagtgccaaacctgagcct
gtcaggagggaaaatgcaaggaagggctctgttgtcaatgtcaatccaaccaatatccgc
ccacaaagtgacagcccagaaatccgtaaatacaagaagaaattcaactccgaggtcctg
tgtgctgctctgtggggggtaaatttattggtgggaacagagaatggattgtggctgctg
gacagaagtgggcaaggaagagtttatactctgattacgaggagacggttccagcaaatg
gatgttctggaaggactcaatgtgctaattactatatcagggaagaagaataagttgagg
gtgtattacttgtcatggttgagaaataaaattttgcgcaacgatccagaggtggagaag
cggcaaggctgggtgtccgtgggtgacctggagggctgtgtgcactacaaagtcgtaaaa
tatgagagaatcaaattccttgtaatcgctttgaaaaactcagtggaggtttatgcctgg
gctccaaagccttatcacaaattcatggcttttaagtcctttacctcacttcatcacaaa
ccactgtcagttgacctgactgttgaaaatgggcaaagactaaaggtcatatatggctca
gtagtgggatttcatgccattgatgtggactctggatctgtgtatgacttgtaccttcca
acacacatccaggggacgattcgcccccatgccattatcatcctcccgaacaccagtggc
atggagctcctgctcacctacgaagatgaaggcatctacattgatatatatgggcatttc
acaaaggagactgttctacagtggggagaaatgccagcatctgtagcttaccttcagtcc
aatcaggtcatgggctggggagaaaaagcaattgaactacgctctgtggaaacaggaaat
ctggaaggagtatttatgcacaagaaagcacagaagctaaaatttctatgtgaaagaaat
gacaaggtgttctttgcatctgtacagtcaggaggcagcagtcaaatatactttatgact
cttggtcaaaatgtactattcaactggtaa

DBGET integrated database retrieval system