KEGG   Taeniopygia guttata (zebra finch): 100219121Help
Entry
100219121         CDS       T01082                                 

Gene name
RAD51
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu03440  Homologous recombination
tgu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100219121 (RAD51)
   03460 Fanconi anemia pathway
    100219121 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100219121 (RAD51)
   04121 Ubiquitin system [BR:tgu04121]
    100219121 (RAD51)
   03400 DNA repair and recombination proteins [BR:tgu03400]
    100219121 (RAD51)
Membrane trafficking [BR:tgu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Others
    100219121 (RAD51)
Ubiquitin system [BR:tgu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100219121 (RAD51)
DNA repair and recombination proteins [BR:tgu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100219121 (RAD51)
    RecA family proteins
     100219121 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100219121 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HHH AAA_22 AAA_24 ssDNA_TraI_N
Motif
Other DBs
NCBI-GeneID: 100219121
NCBI-ProteinID: XP_002196004
UniProt: H0ZAJ0
Position
5
AA seq 339 aa AA seqDB search
MAMQMQLETSADSSAEEESFGPQLISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
LNIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITELFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcagatgcagctcgagaccagtgcagactcctcagcagaggaggagagcttt
gggccacagctcatatccaggttggagcaatgtggcataaatgccaatgatgtgaagaag
ctggaagaagctggatttcacacagtggaggccgtggcttatgcaccaaagaaggagctg
ctgaatattaaagggatcagcgaagccaaagctgacaaaatcttggctgaggcagccaaa
ctggttcccatgggcttcaccacggccacagaattccaccagcggcggtcagagatcatc
cagatcaccactggctccaaagagctggataagctgcttcaaggaggaatagaaacaggg
tccataacagaattatttggggaattccgtactggaaagacgcagctgtgtcacaccctg
gctgtcacctgtcagctccccatagaccgtggcggcggcgagggaaaagccatgtacatc
gacacagaggggaccttccgtccagagcggctcctggctgtggctgaaaggtatggcctt
tctggcagcgatgtcctggacaacgtggcctatgctcggggctttaacaccgaccaccag
acccagctgctgtaccaggcctcggccatgatggctgaatcacggtacgcgctgctgatc
gtggacagcgccacggccctgtaccgcacggattactcgggaaggggagagctctccgcc
aggcagatgcacctggccaggttcctgcggatgctgctgcgcctggccgacgagtttggc
gtggctgtcgtcatcacgaaccaggtggtggcacaggtagacggagctgccatgttcgct
gcagatcccaaaaagcccatcggaggcaatatcatcgctcatgcttccaccaccaggctg
tacctgcggaaaggccgaggtgagaccaggatctgtaaaatctacgactctccgtgtctt
cctgaggctgaagccatgtttgctatcaatgccgatggagtgggagatgctaaagactga

DBGET integrated database retrieval system