KEGG   Taeniopygia guttata (zebra finch): 100219519Help
Entry
100219519         CDS       T01082                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100219519 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    100219519 (CREM)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100219519 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf RicinB_lectin_2 Rh5
Motif
Other DBs
NCBI-GeneID: 100219519
NCBI-ProteinID: XP_030120188
Position
2
AA seq 329 aa AA seqDB search
MTKCAKKYRKGPVRLMTMEMVEQDDNAADSLTERSAGPLRNQPGQNQISSGSEVSVAASS
AGRGSPAVTLVQLASGQTVHVQGVIQATQPSVIQSPHMQAVQVASIADEAAPSEVIIDSQ
KRREILSRRPSYRKILNELSSDAPAVAKIEEEEKSEDEGTPSGISAMAMPTSLYHTNTGQ
YLTISQGGTIQTVTNSGAPQPGATIVQYAAQSSDGTQQFFVPGSQVAVQAATGDMPAYQI
RTPTTTLPQGVVMAASPGTLHSPQQMAEEATRKRELRLLKNREAARECRRKKKEYVKCLE
NRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtgtgccaagaaatatcgaaaaggacctgtcagactgatgaccatggaaatg
gttgaacaggatgacaatgcagcggattctctgacagagagaagtgctggtccccttcgg
aatcagccaggccagaatcagatttcctcaggatctgaggtttctgtagctgcttccagt
gctggaagaggatctccagctgtaactctagtgcagttggcttctggtcaaactgttcat
gtccagggtgtcattcaagctacacagccctcagtcattcagtcaccacacatgcaagct
gttcaggtagcatcgattgcagatgaagctgcaccatcagaagtgataattgattctcaa
aaacgtagggaaatactttcaagaaggccttcataccgaaaaattttgaatgagctctca
tcagatgcacctgcagtagcgaagattgaagaagaagagaagtcagaagatgaaggaacg
ccttctggtatttctgcaatggccatgccaaccagcctgtatcatactaacacagggcaa
taccttaccatatctcaaggtggtacaattcagactgtgacaaattcaggagctcctcag
ccaggcgctaccattgtgcaatatgcagcacagtcatctgatggcacacaacagtttttt
gttcctggaagccaagttgctgttcaagctgccactggagacatgccagcttaccagatt
cgaactcccaccactaccttgcctcagggagtggttatggcagcctcaccagggactttg
cacagccctcagcaaatggcagaagaggcaacacgcaagagagagctgagacttttgaaa
aatagggaagctgccagagaatgtcgcagaaagaagaaagaatatgtcaaatgtcttgaa
aatcgtgtggctgtgcttgaaaaccaaaacaagactctcattgaggaactcaaggccctc
aaagatctttattgtcataaagcagaataa

DBGET integrated database retrieval system