KEGG   Taeniopygia guttata (zebra finch): 100219651Help
Entry
100219651         CDS       T01082                                 

Definition
(RefSeq) prostatic acid phosphatase-like
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100219651
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     100219651
    3.1.3.5  5'-nucleotidase
     100219651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 AGTRAP
Motif
Other DBs
NCBI-GeneID: 100219651
NCBI-ProteinID: XP_002196525
Position
2
AA seq 374 aa AA seqDB search
MRARQLVCGIWSLCFLFCLFCIFLHQTTAKRKLKFVSLVFRHGDHTPQEFFPTDKHKEIA
RQQGYGQLTKLGIQQQYELGQYMRRRYSHFLSVVYKQCEVYVQSTDCDHTLMSAQASLAG
LYPPTQDQIWNPRILWQPIPVHTMPLSQDNLLYMPFSHCPKYKELLRETFATRDFQRQFK
HYKQFLKFLATHTGYPLKKLTSERIWKLSDTLQYEDINNYTLPVWATHGVRTKLIKLSEL
LLQAEFGFHKQIQKSRLQGGILLKTVLKHILDARKPSYHQKMVMYSTHAATIAALQMALN
VFNGKLPPHSACHFFELYQEKNGQYTIEMYYRNNSLREPHPLTLPGCKFRCPLERFTHLV
SPILIHYWTRECRI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaaggcagctggtctgtggaatttggagtctgtgcttcctgttctgtcttttc
tgcatctttcttcaccaaacaacagctaaaagaaaactgaagtttgtgtccctagtattt
cgccatggtgatcataccccacaggagtttttcccaactgataagcacaaagaaattgca
agacaacagggatatggccaacttaccaagcttggcatacaacaacagtatgagcttggc
cagtacatgcggaggagatactctcatttcctgagcgttgtatacaagcagtgtgaggtt
tatgttcaaagcactgactgtgatcacacacttatgagtgctcaggcaagtcttgccgga
ctgtacccaccaacacaggatcagatttggaaccccagaatcctttggcagccaattcca
gttcacacaatgccactgtcacaggacaatttgctatacatgcctttctcacactgccca
aaatacaaggagcttctgagagaaacctttgcaactagagatttccaaaggcaattcaag
cactacaagcaatttctgaagtttctagccactcatacgggatatccattgaagaagttg
actagtgaaaggatttggaagctctctgacactttacagtatgaggatattaacaattac
acactacctgtttgggctactcatggtgtcaggaccaagctgataaagctgtcagaattg
ttattgcaggcggaatttgggttccacaaacaaatacaaaaatcacgtttgcagggagga
attcttttaaaaactgttttaaagcatatcttagatgctagaaagccttcataccatcaa
aaaatggttatgtactccacgcatgcagccaccatcgctgccttacagatggcactcaat
gtcttcaatgggaaattgcctcctcacagtgcctgccatttttttgaactttaccaggaa
aaaaacgggcaatacaccatagaaatgtactaccggaataattccttgagggagcctcac
cccctcaccctccctggctgcaaatttcgctgtcctctggagagatttactcatctggtc
tctcccatccttatacactattggacaagagaatgtagaatttag

DBGET integrated database retrieval system