KEGG   Taeniopygia guttata (zebra finch): 100220427
Entry
100220427         CDS       T01082                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00230  Purine metabolism
tgu00240  Pyrimidine metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100220427
   00240 Pyrimidine metabolism
    100220427
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100220427
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 100220427
NCBI-ProteinID: XP_002195774
Ensembl: ENSTGUG00000001082
UniProt: A0A674GDN7
Position
13
AA seq 364 aa
MANFVYRNANQISKWNSATVTSCTKLSFPFHLPNAHFVRARRQELGRSGGGGGSASASSQ
GGLAGSGHPAHPLGGTLKVRGSSREPPEFPLGTAMSTPAKRHCQSPAGSLESSFQKRLRK
ISIEGNIAAGKSTFVRLLEKHSDEWEIIPEPIAKWCNIQTAEDEYEELSTSQKSGGNLLQ
MLYDKPTRWAYTFQTYACLSRVKAQLKPVSAKLYEAEHPVQFFERSVYSDRYVFASNLFE
SGNINETEWSIYQDWHTWLLNQFQSDIELDGMIYLRTTPQKCMERLQMRGRREEQGIELE
YLENLHYKHETWLHERTMRVDFENIKEIPILVLDVNEEFKNDKIKQEYLIDKVKSFLTSL
EDGN
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcaaatttcgtttacagaaatgcaaatcagatcagtaagtggaacagtgctacagta
acttcctgcacaaagctctcttttccatttcacttgccgaacgcccattttgtaagagcg
cggcggcaggagctgggcaggagcggcgggggagggggcagcgcctccgcctcttcccag
ggagggctggcgggaagcggccatcccgcccacccgcttggcgggacgcttaaagtgcgc
gggagcagccgggaaccccctgagttcccgctcggcaccgccatgtctacccccgccaag
cggcactgccagagccccgccggctccctcgaatccagcttccagaagcgcctcaggaag
atttccatcgaggggaacatcgctgcggggaagtcaacgttcgtcaggctgctggagaaa
cacagcgatgagtgggagatcatccccgagcccatcgctaagtggtgcaacatccagaca
gccgaggatgagtatgaggaactttcaacatctcagaagagtggaggaaacttacttcaa
atgctgtatgataaacccacaagatgggcttacacatttcaaacttatgcttgcttgagc
cgagtaaaagcacaattaaaacctgtctcagccaagctatacgaagcagaacatccagtg
caatttttcgaaagatctgtgtacagtgacaggtatgtgtttgcttctaacctgttcgag
tctggaaatattaatgaaacagagtggtctatttatcaggactggcacacatggcttttg
aatcagtttcaatcagatatagaactggatggcatgatatatctcagaaccacacctcag
aaatgtatggaaaggctacagatgaggggaagaagagaggagcaaggaattgagcttgag
tatttggaaaacctccactataaacatgaaacctggcttcatgaaaggactatgagagtt
gattttgagaacatcaaggagattcctattcttgttctggatgttaatgaagagtttaag
aatgataaaattaaacaagagtacctgattgataaagtcaagtcattcctgacttcttta
gaagatggaaattaa

DBGET integrated database retrieval system