KEGG   Taeniopygia guttata (zebra finch): 100220632Help
Entry
100220632         CDS       T01082                                 

Gene name
GATB, PET112
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00970  Aminoacyl-tRNA biosynthesis
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100220632 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tgu03029]
    100220632 (GATB)
Enzymes [BR:tgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100220632 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100220632 (GATB)
Mitochondrial biogenesis [BR:tgu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100220632 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 100220632
NCBI-ProteinID: XP_012428846
Ensembl: ENSTGUG00000004986
Position
4
AA seq 548 aa AA seqDB search
MAARGCGGVWRRARQRGAGQPGPGLGPFPRGQRAVACNARGGAVPAGKSGLVPWVPVVGL
EIHAQISSNSKLFSGSQVQFAAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCS
INKKSLFDRKHYFYADLPAGYQITQQRVPIAVNGSLSYSLCIDNKMSQMVTKTVRIKQIQ
LEQDSGKSLHDDTRSQTLVDLNRAGVGLMEVVMEPDMCCGEXAAAAVRELQLILQTLGSS
QAVMAEGQLRVDANVSVHHPGEPYGVRTEVKNINSIRFLAKAIDYEIQRQIEELENGGTI
LNETRAFDSKLGCTVPMRDKEGKQDYRFMPEPNLPPLILYDAKSLPANMNHQQVINIDWI
HERLPDLPSVKRKKLVEQYGILPEHSFTLLNEDGLAEFFESVVKQTQMKPKKVIGWILKD
LLSYLKQHSLTVKESPVSSFLLADLLNLLEKKEISSPAAKQVFMELWKGEGKTPLEIVKE
QKLGLLQDQKELEQICQAVIDGQENEVMAIKAGNQKVLNKLIGLVQKKTEGRSNPVLVKQ
LLEKKLSE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgggggtgcggaggggtctggcgccgggcgcggcagcgcggcgcggggcag
ccggggcccgggctcggccctttccctcgcgggcagagggctgtcgcctgtaacgcgaga
ggcggggcggtgccggcggggaagagcggtctcgttccgtgggtaccagttgtgggtctg
gaaattcatgcacagatcagttccaactcaaaactcttctctggttcccaagtccagttt
gcagcacctcccaactctttggtatctttctttgatgcctctttaccaggaactttacca
gttctcaacaggagatgtgtagaagcagcagtgatgacaggcctggctctcaactgcagc
ataaacaagaagtccttgtttgacagaaaacactacttctatgcagatctgcctgctggc
tatcaaatcactcagcaaagagttcctattgcagtgaatggaagtctgtcatacagtctc
tgcatagacaacaagatgagccagatggtgaccaaaactgtgaggattaaacaaattcag
ttggagcaagacagtggaaaaagtctccatgatgatacaaggagccaaacccttgtggac
ttgaatagggctggagttggtctcatggaggttgtcatggagcctgatatgtgctgtggg
gaanaagcagctgcagcagtcagagagcttcagctcattctgcaaacacttgggagcagc
caggcagtcatggcagagggtcagctgagagtggatgccaatgtttctgtgcatcaccct
ggagagccttacggagtgaggactgaagtgaagaatatcaatagcatacgatttctggca
aaagcaatagactatgaaatacagaggcaaattgaagaacttgaaaatggagggacaatt
ttgaatgaaacaagagcatttgattccaagcttgggtgcacagttccaatgagagacaaa
gaaggaaaacaggattatcggttcatgccagagccaaaccttcccccattgattctgtat
gatgcaaaatctttgccagctaatatgaaccatcagcaagtgataaatattgattggatt
catgagagacttcctgacctccccagtgtgaagagaaaaaagcttgttgaacagtatggg
attcttcctgaacacagcttcaccttattgaatgaagacggactagcagaattctttgaa
agtgtggtaaaacagacccaaatgaagccaaagaaggtgatcggctggattctaaaggac
ctgctcagttacttgaaacaacattcccttacagtaaaggaaagcccagttagttctttt
ctcctggctgacctcttgaaccttctagaaaaaaaagaaatttcttctccagcagcaaag
caggtgtttatggaattgtggaagggagaagggaagactccccttgaaattgttaaagaa
cagaaacttggactgttacaggatcaaaaagagcttgaacagatctgccaggcagtgatt
gatggacaagaaaatgaggttatggcgataaaggcaggaaatcaaaaagttctaaataag
ttaattggtctggtacaaaagaagacagaaggacggtccaatcctgttctggtgaagcaa
ttattagagaagaagctatcagagtag

DBGET integrated database retrieval system