KEGG   Taeniopygia guttata (zebra finch): 100220657Help
Entry
100220657         CDS       T01082                                 

Gene name
BDH2
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00072  Synthesis and degradation of ketone bodies
tgu00650  Butanoate metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100220657 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100220657 (BDH2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100220657 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR AlaDh_PNT_C NAD_binding_10 Sacchrp_dh_NADP UDPG_MGDP_dh_N DUF2325 ADH_zinc_N 3HCDH_N UPF0146 UAE_UbL FtsJ
Motif
Other DBs
NCBI-GeneID: 100220657
NCBI-ProteinID: XP_002196239
Ensembl: ENSTGUG00000003730
Position
4
AA seq 245 aa AA seqDB search
MGRLDGKIILLSAAAQGIGRAAAIAFAKEGAKVIATDINESKLQELGKCPGIQVRVLDVT
KKEQIENLAKEIEKIDVLCNIAGFVHHGTILECEEQDWDFTMNVNVRSMYLMIKTFLPKM
LKQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKAVAADFIEQGIRCNCICPGTV
DTPSLQERIQARPNPEQALKDFLARQKTGRMATAEEVAHLFVYLASDESAYVTGNELIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggatgggaagatcatccttttgtctgcagcagcacagggcattggccga
gcagctgctattgcttttgctaaagaaggagccaaagtcattgctacagacatcaatgag
tcaaaactgcaagaactggggaaatgtccaggcattcaagtacgggttctggatgtcacc
aaaaaggagcagatcgaaaatctggccaaggagattgaaaagattgacgtcctctgtaac
attgcagggtttgttcatcatggaaccattctggagtgtgaggagcaagactgggacttc
acgatgaacgtcaatgttcgcagcatgtacctaatgataaagacattccttccaaagatg
cttaaacagaaatctggaaatattataaatatgtcttctgtggcatctagcatcaaagga
gttgtgaacaggtgtgtctacagtacttcaaaggcagcagttattgggctaacaaaggct
gtagctgctgatttcattgaacaaggcatccgatgcaactgcatatgtcctggaactgtt
gacacaccatctttacaggaaagaatccaagcccggcctaatccagaacaggcactgaaa
gactttctagccagacagaaaactggcaggatggctactgcagaagaagtggcccatctc
tttgtgtacttggcttctgacgaatctgcctatgtgactggtaatgaattaatcatcgat
ggaggatggagcttgtga

DBGET integrated database retrieval system