KEGG   Taeniopygia guttata (zebra finch): 100220897Help
Entry
100220897         CDS       T01082                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tgu01009]
    100220897 (PUDP)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     100220897 (PUDP)
Protein phosphatases and associated proteins [BR:tgu01009]
 HAD phosphatases
  Other HAD phosphatases
   100220897 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 100220897
NCBI-ProteinID: XP_030136367
Position
1
AA seq 234 aa AA seqDB search
MAASSCSAAALRPVTHVIFDMDGLMLDTENLYTEVYDGICRRYGKSYTWDVKSMVLGRQA
PEAAGIIRDALNLPITKEEFFLESKTKLEKVFHTAGLMPGVNKLVRHLHKHKIPIGVATS
ASVVSFEIKTTRHKDLFSLFHHIVLGEDPELKRGKPHPDPFLLCAKRFQPPAPPEKCLVF
EDSPQGVRGALAAGMQVVMIPDEQLSPDLKKDATLVLKSMEDFKPELFGLPAYD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttcctcctgctcggcggccgcgctgcgcccggtcacgcacgtcatctttgac
atggacgggctgatgctggatactgagaatctctatacagaagtgtatgacgggatctgc
aggcgttatggaaagtcctatacctgggatgtgaaatccatggttctaggcagacaagcc
ccagaagcagcagggattattcgagatgctctaaatcttccaataaccaaagaagaattt
ttccttgaaagtaaaacaaagctggagaaggtattccatactgctgggttaatgccaggg
gtgaataagctggtccgtcatttacacaaacacaagatacccataggtgttgccaccagc
gcgagtgttgtgtcatttgagataaaaacaaccagacacaaagacttatttagtcttttt
catcatattgtgttgggagaggatcctgagttgaagcgtggcaagccacatcctgatcca
tttttactttgcgcaaagagatttcaacctcctgcaccaccagagaagtgtcttgtgttt
gaagattcaccacagggagtcagaggagccctggcagcaggaatgcaagtggttatgatt
ccagatgaacaactaagtccagatcttaaaaaggatgcaacactggtgctgaagtccatg
gaagatttcaaaccagaactgtttggtttaccagcatatgattga

DBGET integrated database retrieval system