KEGG   Taeniopygia guttata (zebra finch): 100221952Help
Entry
100221952         CDS       T01082                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00564  Glycerophospholipid metabolism
tgu00565  Ether lipid metabolism
tgu00590  Arachidonic acid metabolism
tgu00591  Linoleic acid metabolism
tgu00592  alpha-Linolenic acid metabolism
tgu01100  Metabolic pathways
tgu04010  MAPK signaling pathway
tgu04217  Necroptosis
tgu04270  Vascular smooth muscle contraction
tgu04370  VEGF signaling pathway
tgu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100221952
   00565 Ether lipid metabolism
    100221952
   00590 Arachidonic acid metabolism
    100221952
   00591 Linoleic acid metabolism
    100221952
   00592 alpha-Linolenic acid metabolism
    100221952
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100221952
   04370 VEGF signaling pathway
    100221952
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100221952
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100221952
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100221952
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100221952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100221952
NCBI-ProteinID: XP_030131196
Position
5
AA seq 794 aa AA seqDB search
FVQAPVSPFNLLTVKILRVRNARKADLLTLSDCYVTLWLPTASAEKVRTRTIRNSKNPVW
NEAFCYKIDRRVKNVLELKVCDEDTVTRDDELCTVLFDIDKLTVGRTVRVKFQLNPQARE
ELEVEFTLQNTLDFPDGIITNGVLVAREVSCLEVRVDTGKLKQQSTNPELTFTVKGSHEG
SQKILLASGPSLHIIIFHCIINDQTRLDVLLPEELAGGNETEKSGVLSFPLNSLPLQKEI
ILEEDNSFHLCLTARKCSGDLDVRLGFSLCMEEQNFLRKRKKYVAAALKKILNLEEDLKE
HEVPVVAITTTGGGTRSLTAMYGSLLGLQKLNLLDCISYIGGLSGTTWTMANLYEDANWS
QKYLEDAIKEARKQVTKSKICCFSLDCLKYYYNDLMERTKEGHNTSFIDLWGLVIESMLH
DKKDEHRLSDQRQAVDNGQNPLPIYVAINLKSNYSAQAFREWLEFTPYEVGLLKYGASIR
AEHFGSQFFMGRMVKKLSETRICYMQGMWSSIFSIDAMYVWNLAADSEDFWCRWTRDRVK
DIAEEPFLSVNPYEVDTCLFTPSSVFSSTLRDVLTGRPTIAQYPNFIRGFQLHNKYLESE
GFSTWKDTVIDSFPNKLMETADNELSLVDTGFFINTSYPPLLRSNREVDVILHLNYSGGS
QTLPLDQIAKYFSEQEIPFPKIEISEEDRENLKECYVFEEADSPQAPTVLFFPLVNDTFK
KYKAPGVERSPEEMAEGKVDVSSILSPFTTREVCFSEENFDKLVKLTDYNVLNNEKLIIQ
ALRLAVARRKQRKY
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
tttgtgcaggcaccagtatctcccttcaacttgctcactgtaaaaatactaagagtgagg
aatgcccggaaggcagacttgctcaccctttcagattgttatgtgacactgtggctgcct
actgcctcagcggagaaggttcggaccaggaccatcaggaacagcaaaaaccccgtttgg
aatgaagcgttctgctacaagattgaccgccgtgtcaagaatgtgctggagctgaaggtc
tgtgatgaagacacagtcaccagggatgatgaactctgcacagttctcttcgacatagat
aagctcactgtgggacgtactgtccgcgtgaagtttcagctgaatccacaggcacgggag
gagctggaggtggagttcacactgcagaacactctggactttcctgatggcattattaca
aatggagtactagtggcacgtgaggtttcctgtttggaggttagagtggatacagggaag
ctgaagcagcaatccacaaacccagagcttacatttacagtgaaaggatcacatgaagga
agccagaagattttgctggcctctggccccagtcttcatataatcatatttcactgcatc
ataaatgaccagacaaggctggatgtcctattaccagaagagctggctggtggaaatgaa
acggagaaatcgggggtcctttctttccccctgaattcactccctttgcagaaagaaata
atactagaagaggataattcatttcacttgtgcttgacagcgagaaaatgctcgggagac
ctggatgtgcgcctggggtttagcctgtgcatggaggagcagaacttcctgcggaaaagg
aaaaaatatgttgctgctgctctgaaaaagattcttaatttggaagaggatctgaaagag
catgaggtgccagtggtggccattacaacaaccgggggaggaacgagatcactcacagcg
atgtacggcagcctgctgggcctccagaaactcaacctcttggactgcatttcctacatc
gggggtttatcgggtaccacatggaccatggcaaacttatatgaagatgctaattggtca
caaaaatatctagaggatgcaatcaaggaagctcgcaagcaagtaaccaaatccaagatc
tgctgtttttctttggattgtctgaagtactattacaatgacctgatggagaggactaaa
gaaggacataacacttctttcatagacctttggggtcttgtcattgaatccatgctacac
gataagaaagatgagcatagactctcggaccagcgtcaggcagtggataatggccagaat
ccactgcccatctatgtggccatcaacctcaagtccaactatagtgcccaggcattcaga
gagtggctagagttcactccttacgaagttggtctgctgaagtatggagcatctattcgc
gcagaacactttggaagtcagttctttatgggaaggatggtgaagaagctctcagagact
cggatctgctatatgcaaggcatgtggagtagtatattttccatagatgcgatgtatgtc
tggaatttggctgctgattcagaagatttctggtgcagatggaccagagacagagtaaaa
gatatagcagaagaaccctttctgtctgtgaatccctatgaagtagacacgtgtctattc
actccctcaagtgtcttctcctccactctgcgagatgtcttaacaggacgtccaaccatt
gcacagtatcccaattttatcagaggcttccagctgcataacaagtacctggagagtgaa
ggattttctacctggaaagacacagtgatagactcctttccaaataaactgatggaaaca
gcagacaatgagctctccctggttgatactggctttttcattaataccagctacccacca
cttttgagatcgaacagggaagtcgatgtcatcctccatttgaattacagtggagggtcc
caaacactgcctctggatcagattgcgaagtacttctcagagcaagaaattccatttccc
aaaattgagataagtgaggaagacagggaaaacttgaaggagtgctatgtgtttgaagag
gctgacagtccacaggctcccacagtgcttttctttcccctagtaaatgacaccttcaag
aaatataaagctcccggtgtggaaagaagtcctgaagagatggctgaaggcaaagttgat
gtctccagcatcctctctccatttacaacaagagaggtgtgtttcagtgaagagaatttt
gacaaactggtgaaactgacagattacaacgtcctgaacaatgagaagttgattattcag
gccttgcgcttggcagtggcacggaggaagcagcggaagtattaa

DBGET integrated database retrieval system