KEGG   Taeniopygia guttata (zebra finch): 100221958Help
Entry
100221958         CDS       T01082                                 

Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100221958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 Ubie_methyltran GCD14 MTS Methyltransf_32 Methyltransf_23 Methyltransf_18 PrmA
Motif
Other DBs
NCBI-GeneID: 100221958
NCBI-ProteinID: XP_012429499
Ensembl: ENSTGUG00000007336
Position
5
AA seq 248 aa AA seqDB search
MSQLPSSAVLALMGLLFARTMAWTSSGKTHAELVNNLYKKGIIKSQRVFDVLLATDRGHY
IKYFPYMDSPQSIGYKATISAPHMHAHALELLKDQLVEGAKALDVGSGSGYLTACFARMI
GPTGKAVGVEHIKELVHESIRNVQEDDPTLLSSGRVKLVVGDGRQGYPEEAPYDAIHVGA
AAATVPKELLKELKPGGRLIVPVGPEGANQVLMQYDKTSDGNIIETQLMGVIYVPLTDKE
KQWPRDDL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctgccgtccagcgccgtgctggcactcatggggctgctcttcgccaggacc
atggcctggacatccagcgggaaaacgcacgcggagctggtcaacaacctctacaaaaaa
gggatcattaagtctcagcgagtcttcgatgtgctgttggctacggacagaggtcactac
atcaagtatttcccatacatggattctcctcaatccattggctacaaggctacgatcagc
gccccgcacatgcacgcccacgcgctggagctgctcaaggatcagctggtggaaggtgcc
aaggcgctggatgtgggatctgggagcggatacctcaccgcgtgcttcgccagaatgatt
ggcccgacgggaaaagctgtgggtgtggagcacatcaaggagctggtgcacgaatccatc
cgcaacgtccaagaagatgatccgacgctgctcagctccggccgtgtgaagcttgtggtt
ggagacggcaggcagggataccccgaggaggctccttacgatgccatccatgtgggagcg
gctgcagccaccgtccccaaggagctgctgaaggagctgaagccaggcgggcgactgatc
gtgcccgtggggcccgagggagcgaaccaggtgctgatgcagtacgacaagaccagcgac
gggaacatcatcgagacccagctcatgggcgtcatctacgtccctctcacagacaaggaa
aagcagtggcctcgggatgacctctga

DBGET integrated database retrieval system