KEGG   Taeniopygia guttata (zebra finch): 100222171
Entry
100222171         CDS       T01082                                 
Symbol
ABCG1
Name
(RefSeq) ATP-binding cassette sub-family G member 1 isoform X1
  KO
K05679  ATP-binding cassette, subfamily G (WHITE), member 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100222171 (ABCG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tgu02000]
    100222171 (ABCG1)
Transporters [BR:tgu02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG1, 4 subgroups
    100222171 (ABCG1)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 SMC_N RsgA_GTPase AAA_13 AAA_29 AAA_16 MMR_HSR1 AAA_23 AAA_18 AAA_22 AAA_28 AAA_30 Rad17 DO-GTPase2 Cytidylate_kin AAA_25
Other DBs
NCBI-GeneID: 100222171
NCBI-ProteinID: XP_030139534
Ensembl: ENSTGUG00000005541
Position
1:complement(109576821..109633053)
AA seq 666 aa
MACLMAAFSLGSALGGSSSGCTMAEPKSVCVSVDEVVSNGTDTQDIRLINGHLKKVDNAL
TEAHRFSYLPRRPAVNIEFKELSYSIQEGPWWRKKGYKTLLKGISGKFSSGELVAIMGPS
GAGKSTLMNILAGYRETGMKGEILINGQPRDLRSFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLACANTRTGSLSGGQRKRLAIALELVNNPPVMFF
DEPTSGLDSASCFQVVSLMKALAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCIYRGK
VTNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVRERICDTDYKRDVVGE
HELNPFLWHRPSEEDSSSTEGCHSFSASCLTQFCILFKRTFLTIMRDSVLTHLRITSHIG
IGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLNYW
YSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDALRFVLFAALGTMTSLVAQSLG
LLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILS
IYGLDREDLHCDKDDTCHFQKSEAILKELDVENAKLYLDFIVLGIFFFSLRLIAYFVLRY
KIRAER
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggcatgtctgatggcggctttctccctgggcagcgctttgggtggcagcagttctggt
tgcaccatggccgagccaaagtctgtgtgtgtttctgtggacgaggtggtctccaatggc
acagacacccaggacatccgactcatcaatggacacttaaaaaaagtggacaatgctctg
acagaagcccacaggttctcctacctgccccgcaggccagctgtgaacattgagtttaaa
gaactgtcctactctatccaggaagggccatggtggagaaagaaaggttataagaccctt
ttgaaaggaatttcagggaaattcagcagtggagaactcgttgcaattatgggaccttca
ggagctgggaagtcaacgcttatgaatattctggcaggatacagagagacggggatgaaa
ggagaaatcctcatcaacgggcagccccgcgacctgcgctccttccgcaaggtctcctgc
tacatcatgcaggatgacatgctccttcctcacctcactgtccaggaagctatgatggta
tctgctcatctgaaacttcaagagaaagatgaagggaggagagaaatggtgaaggaaatc
ctgacagcccttggtttgctggcgtgtgccaacaccaggactgggagtctctcaggaggc
cagaggaagcgcctcgccatcgctctggagctggtgaacaaccctcctgtcatgttcttc
gatgaaccaaccagtggcttggacagtgcatcatgtttccaggtggtctctctgatgaag
gctttggcccagggtggcagatccatcatctgcacgattcaccagcccagtgcaaaactg
tttgagctctttgaccagctctatgttctaagtcaaggtcagtgcatttaccgtgggaag
gtgacaaacctcgtcccttacttgagagatttggggttgaattgtccaacctaccacaac
ccagcagattttgtgatggaagtggcctcgggtgagtacggggaccagaacagccgcctg
gtcagggctgtgagggagaggatttgtgacacagactacaagagagacgtggttggggag
cacgagctgaaccccttcctctggcaccggccctctgaagaggactcatcctccacagaa
ggctgccacagcttctctgccagctgcctaacccagttctgcatcctcttcaaaagaact
ttcctcaccatcatgagagactcggtcctgacacacttgaggatcacctcacacattggc
attgggctgctcattggattgctctacttgggcattggcaatgaagccaagaaagtcctc
agcaactcggggttcctcttcttctccatgttgttcctcatgtttgctgcgctcatgccg
accgtcctcacctttccccttgagatgggagtgtttctcagagagcacctgaactactgg
tacagcctaaaagcctattacctcgccaaaaccatggctgatgttcctttccagatcatg
ttccctgtggcttactgcagcatcgtgtactggatgacttcccagccctccgacgcgctc
cgcttcgtcctcttcgcagccctggggaccatgacatccctggtggctcagtcactgggc
ctgctcataggtgcagcctccacatccctccaggtggcaacttttgtgggcccagttact
gccatcccagtcctcctgttctctgggttttttgtcagctttgacaccatcccaacatac
ctccagtggatgtcctacatttcctatgtcagatatgggttcgaaggagtcatcctctcc
atctacggactggatcgagaagatctgcattgtgacaaagatgacacctgccacttccaa
aaatcagaggccatcctgaaagaactggatgtagaaaatgccaaactttacctggacttc
attgttcttgggattttcttcttctctctgcgcctgattgcctattttgtcctcagatac
aaaatccgagcggagaggtaa

DBGET integrated database retrieval system