KEGG   Taeniopygia guttata (zebra finch): 100222313
Entry
100222313         CDS       T01082                                 

Gene name
NMUR2
Definition
(RefSeq) neuromedin-U receptor 2
  KO
K05053  neuromedin U receptor 2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100222313 (NMUR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tgu04030]
    100222313 (NMUR2)
G protein-coupled receptors [BR:tgu04030]
 Rhodopsin family
  Peptide
   Neuromedin U
    100222313 (NMUR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4
Other DBs
NCBI-GeneID: 100222313
NCBI-ProteinID: XP_002195061
Ensembl: ENSTGUG00000000747
Position
13
AA seq 396 aa
MAWVSNFSWLNHLALHEERLRGYLNSTEDYLTFLCGPRRSHLFLPMALVYSVIFVVGVVG
NFLVCLVILKHRNMKTPTNYYLFSLAVSDLLVLLFGMPLEVYEMWSNYPFLLGPVGCYLK
TALFETVCFASILSVTTLSVERYVAVLHPLRAKLASTRRRALRTILALWLLSVLFALPNT
GTHGIVLQRFPNGTLVPGSATCTVVMPLWIYNCIVQITSLLFYVLPMGVISVLYYLMGLR
LKGDESLEVEEMAVNVQRPSRRSVTKMLFVLVIVFAICWAPFHIDRLFFSFVVEWTEPLA
NTFNLIHVVSGVFFYLSSATNPIIYNLLSQRFRMAFLSVISPCCKHCAPKHPTCKISSQK
SMFVIEDHNLMDSAENTSLPGTHRTSVSSSQLSTGL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcctgggtcagtaatttctcctggttaaaccaccttgctctacatgaagaacgtctc
agagggtacttaaacagcactgaggattatttaaccttcctgtgtgggcccagacggagc
cacctgttcctgcccatggctttggtgtactcggtgatcttcgttgtcggggtggtgggg
aacttcttggtttgcctcgtcatcctcaagcaccgcaacatgaagaccccgaccaactat
tacctgttcagcctggcggtctcagacctgctggtgctgcttttcgggatgcccctggaa
gtctacgagatgtggagcaactaccccttcctgctggggcccgtgggttgctacctgaag
acggctctcttcgagaccgtgtgcttcgcctccatcctgagcgtgaccacgctgagcgtg
gagcgctacgtggccgtcctgcacccgctgcgcgccaagctggccagcacgcgccgccgc
gccctcaggaccatcctggccctctggctgctctccgtgctcttcgccctgcccaacacg
ggcacccacggcatcgtgctgcagcgcttccccaacggcaccctggtgcccggctctgcc
acctgcaccgtggtcatgcccctgtggatctacaattgtattgtccagatcacttctttg
ctcttctatgtgctgcccatgggggtgataagtgtgctgtactatctcatggggctaaga
ttgaaaggagatgaatctttggaagtggaggaaatggctgtgaatgttcagaggccatcc
aggagatcagtcaccaagatgttgtttgtccttgtgatagtttttgccatctgctgggct
ccattccacatagaccgacttttcttcagctttgttgtggaatggactgagcccttggcc
aataccttcaacttaattcatgtggtgtcaggtgttttcttctacctgagctctgccacg
aaccccatcatttacaacctgctgtcccagcgcttcaggatggctttcctcagtgtgatt
tctccttgctgcaagcactgtgcccctaaacatcccacttgcaagatttcatcccagaag
agcatgtttgtgattgaggatcacaatctcatggactctgctgaaaacacaagtctccct
ggcactcacaggacatctgtcagcagctctcagctctccactggcctgtga

DBGET integrated database retrieval system