KEGG   Taeniopygia guttata (zebra finch): 100223331Help
Entry
100223331         CDS       T01082                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00230  Purine metabolism
tgu00240  Pyrimidine metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100223331 (DCK)
   00240 Pyrimidine metabolism
    100223331 (DCK)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100223331 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 DUF5066 IIGP
Motif
Other DBs
NCBI-GeneID: 100223331
NCBI-ProteinID: XP_002194377
Ensembl: ENSTGUG00000001636
Position
4
AA seq 257 aa AA seqDB search
MATPPKRSRTHGRLRKVAVEGNIAAGKSTFVNILKQAGEEWEVVPEPVARWCNVQQSSGD
DCEELSTSQRSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLGALERKRGDAQNPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGSRLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTNFDYLQEIPILTLDVNEDFKGKK
DRYDHMIDKVKEFLSTL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagcgcagccggacccacggccgcctcaggaaagtcgccgtggag
ggcaacatcgctgcagggaaatccacctttgtgaatattctgaaacaagccggtgaggag
tgggaagtggttcccgagcctgtagctagatggtgcaatgtccagcaaagctctggagac
gactgtgaggagctgagcacgtcgcagaggagcggcgggaacgttctgcggatgatgtat
gagaagccggagcgctgggccttcaccttccagacgtacgcctgcctcagcaggatccgg
gctcagctcggcgccctggagcgcaagcgcggggacgcgcagaatcccgtggtgttcttc
gagcgctccgtctacagtgacaggtacatctttgctgctaatttatacgagtctgactgc
atgaacgagaccgagtggacaatttaccaggactggcacgactggatgaataaacagttt
ggctcgaggctggctctggatgggatcatttatctccgagccactcctgagaaatgtttg
aataggatttacttgcgtggaagagatgaggaacaagaaatccccattgaatatctggag
aagcttcactacaaacatgaaagttggctccagcacaggacactgcgaacaaattttgac
tatcttcaggaaattccgattttaacgcttgatgttaacgaagacttcaaaggcaaaaag
gacagatatgatcacatgatcgataaggtcaaggaatttttgagcacgttgtaa

DBGET integrated database retrieval system