KEGG   Taeniopygia guttata (zebra finch): 100223555Help
Entry
100223555         CDS       T01082                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04115  p53 signaling pathway
tgu04210  Apoptosis
tgu05164  Influenza A
tgu05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100223555 (CYCS)
   04115 p53 signaling pathway
    100223555 (CYCS)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100223555 (CYCS)
   05168 Herpes simplex infection
    100223555 (CYCS)
   05163 Human cytomegalovirus infection
    100223555 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100223555
NCBI-ProteinID: NP_001137145
Ensembl: ENSTGUG00000002866
UniProt: B5FZX0
Position
2
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKVATAK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgttgagaagggcaagaagatctttgtccagaaatgctcccagtgccacacg
gttgaaaagggaggcaagcataagactgggcccaacttgaatggcctattcggacgcaag
actgggcaagctgaaggtttctcttacacggatgctaataagaacaaaggtatcacctgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtatattcctggaacaaag
atgatttttgcgggtattaagaagaagggcgagagagcagacttaatagcatacctcaaa
gttgccactgcaaagtaa

DBGET integrated database retrieval system