KEGG   Taeniopygia guttata (zebra finch): 100223686Help
Entry
100223686         CDS       T01082                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04110  Cell cycle
tgu04114  Oocyte meiosis
tgu04120  Ubiquitin mediated proteolysis
tgu04914  Progesterone-mediated oocyte maturation
Module
tgu_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100223686 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100223686 (CDC27)
   04114 Oocyte meiosis
    100223686 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100223686 (CDC27)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100223686 (CDC27)
Ubiquitin system [BR:tgu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100223686 (CDC27)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100223686 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_19 TPR_16 TPR_14 TPR_6 TPR_9 ChAPs TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 100223686
NCBI-ProteinID: XP_002192972
Ensembl: ENSTGUG00000001915
Position
27
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVMEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTVVSNHNISHRQPESVLMETPQDTIELNRINLESSNSKYSSLNSDSSMSYIDSAV
ISSDSVPLGSGTAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNSSSVIDVPSTGAPSKKTVSRISQAGTKSVFSQSGNSREVTPVLVAQTQSSGPQTST
TPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGI
TQPNLNDSLEITKLDSSIISEGKISTVAPQIQAFTLQKAAAGLMSLLRDMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITREEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatctggcaagcactgaaccactacgcg
tatcgcgatgccgtgttcctcgcagaaaggttatatgcagaagtacactcagaagaagca
ctgtttttactggcaacgtgttactaccgctcaggaaaggcctacaaagcttacaggctc
ctaaagggacacagctgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtg
gacctcagcaagcttgcagaaggagagcagatcttgtctggtggagtgttgaataaacag
aaaagccatgatgacattgttatggagtttggtgactctgcatgctttacactctcctta
ctgggacatgtctactgcaagacggaccggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgaatcactatgtgaaataggtgaa
aagccagaccctgaccaaacatttaaattaacatccttacagaacttcagcagctgtctg
cccaacacttgcacaacagtggtgtctaatcacaacatatcccacagacagcctgagagt
gtcctcatggagacaccccaggacacaattgagttgaacagaatcaacctagaatcctcc
aattcaaagtattcctccttgaattcggattcttctatgtcttacattgactctgctgtg
atttcctcggattctgtccccctggggtcaggaactgccatattgtccaaacaggctcaa
aataaaccaaaaactggacggagtttactggggggacctgcagctttgagcccactaact
ccaagctttggaattttgccactggaaaccccgagccctggagatggatcctatttacag
aactacaccaactcctcctctgtaattgatgtgccatccaccggagcaccttcaaagaag
actgtcagcaggatcagccaggctggaacaaaatccgtcttctcccagagtgggaatagc
cgggaagtcactccagttcttgttgcacaaacacagagctctggtccacagacaagtaca
acacctcaggtattgagcccaaccattgctgctccacccaacgcgctgcctcgacgaagc
tctcgcctgttcaccagtgatagttccacaaccaaggaaaatagcaaaaaattaaaaatg
aagtttccacctaagattccaaacagaaaaacaaaaagtaaaacaaataagggaggaata
actcaaccaaacttaaatgacagtttggaaattaccaaactggactcttccatcatttca
gaagggaaaatttccactgttgcaccacaaatccaagctttcacgctacagaaggcagca
gcaggtttgatgagccttctccgggacatggggaaaggttatttagccttgtgctcatac
aactgcaaagaagccatcaatattttgagccatttgccatcccaccactacaacacaggc
tgggtgctgtgccaaattgggagagcttactttgagctggcagaatacatgcaggctgag
cgaatattttcagaagtgaggaggattgaaaactacagagtggaaggcatggaaatctat
tcaaccacactctggcatctgcagaaagatgttgccctttcagtcctttctaaggatttg
acagacatggataaaaactcaccagaggcctggtgtgctgcagggaactgcttcagcttg
cagagggagcacgacattgccatcaagttcttccagagggccatccaggtggatccaaac
tacgcctatgcctacaccctgctgggccacgagtttgtgttgacagaagagctggacaag
gcgttggcctgtttcaggaatgccatcagagttaacccccggcactacaacgcctggtac
gggttgggaatgatttattacaagcaggagaagttcagtctggcagaaatgcatttccag
aaagcacttgatatcaaccctcagagctcagtcctgctgtgtcacattggagtagtccaa
catgcactgaaaaaatctgagaaggctttggacaccttgaacaaagcgatcaacatcgac
cccaagaacccactatgcaaattccacagagcctcggtgttatttgcaaacgagaagtac
aagtcggctttacaagaacttgaagaactgaaacagattgttcccaaagagtctcttgtt
tactttttaataggaaaggtttataaaaagctgggtcagacgcatctggccctaatgaat
ttctcctgggcaatggacctggatcccaaaggagccaacaaccagatcaaggaggccata
gacaagcgctacctgcccgatgacgaggagcccatcacccgcgaggagcagatcagcgag
tgctacccctacgagtcagtgggcacagacgagtcccaggagagcagcatgacggatgcg
gatgacacgcagctccacgccgtggaaagcgatgaattttaa

DBGET integrated database retrieval system