KEGG   Taeniopygia guttata (zebra finch): 100224028Help
Entry
100224028         CDS       T01082                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00561  Glycerolipid metabolism
tgu01100  Metabolic pathways
Module
tgu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100224028 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tgu01002]
    100224028 (MGLL)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100224028 (MGLL)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S33
   100224028 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 DLH Abhydrolase_2 PGAP1 Peptidase_S9 Thioesterase Abhydrolase_5 DUF2436 FSH1 DUF1350 LIDHydrolase Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 100224028
NCBI-ProteinID: XP_002194307
Ensembl: ENSTGUG00000007991
Position
12
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQYLFCRYWKPAASPRALVFIAHGAG
EHCGRYDDLAQKLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKEHP
KLPVLILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPIL
VLHGSSDKLCDIRGSYFLMDTVQSQDKTLKVYEEAYHALHKELPEVSTSVFTEILTWIGQ
KVSAAGETSHT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcgccaaagcggagtcctcaa
aacatcccatacaaggatctgccccatatcatcaatgctgatgggcagtatctcttctgc
aggtattggaagccagcagcatctcccagggcccttgtgtttattgcccatggcgctggg
gagcactgcggccgctacgatgacttggcccagaagctgacaggactcaacttgtttgtg
tttgcccatgaccatgttggccatgggcagagcgagggcgatcggatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagagcacccc
aaactgcctgttctcatcctggggcattccatggggggagccatctccattctgacagct
agtgagcgacccagtgagttttcaggcatgctgttaatctctcctttagtggtagccagc
ccagaagtcgctactcccatcaaggtttttgcagcaaaagtgctcaactttgtgctccca
aacctatcactggggtcgatagatccaaatgcaatttcccgaaacaagaaagagatggag
tcttacacatctgatcccttggtctaccacggtggcatgaaggtctccttcgtcatccag
ctgatgaatgccattgccagaatcgagcgagccctgcccaagctgactctgcccatcctg
gtgctacacggctcttccgacaagctctgcgatatcaggggctcctatttcctgatggac
acagtgcagagtcaggacaaaacgctcaaggtgtatgaagaagcctatcatgccctccac
aaagagctgcctgaggtctctacctctgtcttcacagaaatactgacatggattggccag
aaggtctcagcagctggggaaaccagccatacttaa

DBGET integrated database retrieval system