KEGG   Taeniopygia guttata (zebra finch): 100224188Help
Entry
100224188         CDS       T01082                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu04012  ErbB signaling pathway
tgu04068  FoxO signaling pathway
tgu04070  Phosphatidylinositol signaling system
tgu04140  Autophagy - animal
tgu04150  mTOR signaling pathway
tgu04210  Apoptosis
tgu04218  Cellular senescence
tgu04370  VEGF signaling pathway
tgu04510  Focal adhesion
tgu04620  Toll-like receptor signaling pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04810  Regulation of actin cytoskeleton
tgu04910  Insulin signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04933  AGE-RAGE signaling pathway in diabetic complications
tgu05164  Influenza A
Module
tgu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100224188 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100224188 (PIK3CD)
   04370 VEGF signaling pathway
    100224188 (PIK3CD)
   04068 FoxO signaling pathway
    100224188 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100224188 (PIK3CD)
   04150 mTOR signaling pathway
    100224188 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100224188 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    100224188 (PIK3CD)
   04218 Cellular senescence
    100224188 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100224188 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100224188 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100224188 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100224188 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    100224188 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100224188 (PIK3CD)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100224188 (PIK3CD)
  Infectious diseases
   05164 Influenza A
    100224188 (PIK3CD)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100224188 (PIK3CD)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100224188 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 100224188
NCBI-ProteinID: XP_012425888
Position
21
AA seq 1094 aa AA seqDB search
MGRAAFVCPQGTIAPAGVVPLKGLHEFDSVQDPEVSDFRTKMCQFCEEKAAKRQQLSWAA
WMEYNFPLQLEPVAKGLGVGSLQIPTKNIFVNIKFQSGGESFTFQISPWEFPITLMSYAI
KKQATVFRHETVQKPEDYTLQVNGKCEYLYGNYPLYQFQHIRSCLQRGRTPHLTMVHSSA
IIAMRDEQTNGITSPPKAAPKPPPLPKKKPNYGSLWSLEQPFYIELVQGSKVNADERMKL
VVQAGLFHGTEMLCKTVSSSEVSVCSEPVWRQRLDFDISVCDLPRMARLCLALYAVVEKA
KKARSTKKKSKKADCPIAWVNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQC
NPNTESAAALVICFPSVAAHPVYYPSFAQLLELGRNGEQPRAAPEDSEEKLQLREILERR
SHTELYEHEKDLVWKMRYDIRDQYPQALAKLLVITKWNKHEDVAQMISLLQTWPELPVLN
ALELLDFSFPDRYVGSFAVNSLKKLTDDDVFQYLLQLVQVLKYESYLDCELTKFLLERAL
SNRKIGHFLFWHLRSEMHVPAVALRFGLILEAYCRGSTHHMKVLMKQGEALNKMKALNDF
VKVSSQKATKPQTKEMMHMCMKQETYREALSHLQNPLNPNIILAEVCVDQCTFMDSKMKP
LWIVFNNEETGGGGVGIIFKNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTG
DKTGLIEVVMHSDTIANIQLRRPGQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRETG
QLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYCERAYM
ILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEALRE
SWKTKVNWLAHNNPGDALDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRETGQLFHI
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYCERAYMILRRH
GLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEALRESWKTK
VNWLAHNVSKDNRQ
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagctgcttttgtgtgccctcaagggacgatcgctcctgccggggttgttcct
ctcaaaggtttgcacgagtttgactctgtgcaggacccggaggtgagcgatttccgcacc
aagatgtgccagttctgcgaggagaaagcagcgaagcggcagcagctcagctgggcagcg
tggatggagtacaacttccccctgcagctggagcccgtggccaagggcctcggtgttggc
tctctgcaaatccccaccaagaatatttttgtcaacatcaagttccagtctggcggggag
agcttcaccttccagatctccccctgggagttccccatcaccttaatgagctatgccatt
aagaaacaggccactgtgttccgccacgagaccgtgcagaagccagaggactacaccctg
caggtgaatgggaaatgtgaatatctctatgggaactaccccctgtaccagttccagcac
atccgcagctgcctgcagcggggccggaccccgcacctgaccatggtgcactcctctgcc
atcattgccatgagggacgagcagaccaacggcatcaccagccccccaaaggcggccccc
aagccccccccgctccctaagaagaagccaaactacggctctctctggtccttagagcag
cctttctacatcgagctggtgcaaggcagcaaggtcaatgcagatgagaggatgaagctg
gtggtgcaggcagggctgttccacggcactgagatgctgtgcaagaccgtgtcgagctcg
gaggtgagcgtgtgctcggagccggtgtggaggcagcgcctggacttcgacatcagcgtc
tgcgacctgccccgcatggcgcggctctgcctcgccctctacgccgtcgtcgagaaggcc
aagaaggctcgttccaccaagaagaagtccaagaaagctgactgtcccatcgcctgggtc
aacgtgatgctcttcgactacaaggaccagctgaaaacaggggagtgctgcctgcacatg
tggtcctccttcccagatgagaaaggggaacttctgaaccccatgggcacagtgcagtgc
aaccccaacacggagagtgcagcagccttggtcatctgcttccccagcgtggcagcacat
cctgtgtactacccatcctttgcgcagctgctggagttgggaaggaatggagagcagccc
cgagcggcaccagaggattctgaggagaagctgcagctgagggagatcctggagcggagg
agccacacggagctgtacgagcacgagaaggacctggtgtggaagatgcggtacgacatc
cgcgaccagtacccgcaggccctggccaagctgctcgtcatcaccaagtggaacaagcac
gaggatgttgcccagatgatttccctgcttcagacctggccagagctgcctgtcctgaat
gccttggagctgctggatttcagctttcctgaccgttacgttggttcctttgctgtcaac
tccctgaagaagctgacggatgatgatgtgttccaatacctgctgcagcttgtccaggtg
ctcaagtatgaatcctacctagactgtgaattaaccaagttcctgctggaaagggcatta
tccaaccgcaagatcggccacttcctcttctggcatctgaggtcggagatgcacgtgccc
gccgtggccctgaggtttgggctgatcctggaagcgtactgccggggcagcacccaccac
atgaaggtgctgatgaagcagggagaagcactgaacaagatgaaagctctgaatgacttt
gtgaaagtgagttctcagaaggccaccaagcctcaaaccaaggagatgatgcatatgtgc
atgaagcaggaaacctacagggaagccctttcccacctccagaaccccctgaaccccaac
attatcctcgctgaagtttgtgtggatcagtgcacctttatggactccaaaatgaaacct
ttgtggattgtgtttaataatgaagagacaggtggaggaggagtgggtataatttttaaa
aatggagatgatctgcgccaggacatgctgaccctgcagatgatccagctgatggacatc
ctgtggaagcaggagggcctggacctgaggatgaccccttatggctgcctctccacagga
gacaagacggggctgattgaggtggtcatgcactcggacaccatcgccaacatccagctc
agacgcccaggccaagccatcgaggagttcaccctttcctgtgctgggtactgcgtggcc
acatacgtgctgggcattggggaccggcacagcgacaacatcatggtccgggagacgggg
cagctgttccatattgattttggtcactttttggggaacttcaagactaaatttggtatt
aatagagaacgagtccctttcatcttaacctatgactttgtgcatgtcatccagcaagga
aaaactaacaacaacgagaagtttgaaaggttcaggggttactgtgaaagggcctacatg
atcctgcggcgccacgggctcctcttcctgcacctctttgcactgatgaaggctgctggg
ctgcctgagctcagctgctccaaagacatccagtacctaaaggactccctggcccttggg
aaaaccgatgaggaggcactgaagcacttcagagtgaagttcaatgaagccctgcgggag
agctggaaaaccaaagtgaactggctggcacacaacaacccgggagatgccttggaccaa
gccatcgaggagttcaccctgtcctgtgctgggtactgcgtggccacctacgtgctgggc
attggggaccggcacagcgacaacatcatggtccgggagacggggcagctgttccatatt
gattttggtcactttttggggaacttcaagactaaatttggtattaatagagaacgagtc
cctttcatcttaacctatgactttgtccatgtcatccagcaaggaaaaactaacaacaat
gagaagtttgaaaggttcaggggttactgtgaaagggcctacatgatcctgcggcgccac
gggctcctcttcctgcacctctttgcactgatgaaggctgctgggctgccagagctcagc
tgctccaaagacatccagtacctaaaggactccctggcccttgggaaaactgatgaggag
gcactgaagcacttcagagtgaagttcaatgaagccctgcgggagagctggaaaaccaaa
gtgaactggctggcacacaacgtatccaaagacaacaggcagtag

DBGET integrated database retrieval system